Recombinant Full Length Archaeoglobus Fulgidus Uncharacterized Protein Af_2058 (Af_2058) Protein, His-Tagged
Cat.No. : | RFL18701AF |
Product Overview : | Recombinant Full Length Archaeoglobus fulgidus Uncharacterized protein AF_2058 (AF_2058) Protein (O28221) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Archaeoglobus fulgidus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MPKKLVLVIDRDDDLGQKAGISSPVIGRDNIVSAAVRLGTADPEDSDVNAMFAAIKIYDE LKGRGEDVEVVVVCGDRSVGVVSDSKIAEQLDRVVLNLRPSSAIVVTDGSEDEFVLPIIS SRVKIDSVHRVVVRQSRTIESTYFLIRRMLNDPKIARITLAPLGMIFLVYSIFLVMQHPE WGLGGIIFFLGVYFMVKAYGWEQNIANLLETVRVSLVEGRLSFIFYVTSAILLIISIVNG FNAAVNIADAAQAISSFIFYSTWWFVLSGIFALLARAADAYAEKRRVSKYFTIIFLLIAF GLIVWASAAYVLNPEAPNALQNLAGAIVGAILIAAIGVFTLKRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AF_2058 |
Synonyms | AF_2058; Uncharacterized protein AF_2058 |
UniProt ID | O28221 |
◆ Recombinant Proteins | ||
FLT3L-1888H | Active Recombinant Human FLT3L protein | +Inquiry |
COMFB-0673B | Recombinant Bacillus subtilis COMFB protein, His-tagged | +Inquiry |
ENHO-3227B | Recombinant Bovine ENHO, GST-tagged | +Inquiry |
RASL10B-13958M | Recombinant Mouse RASL10B Protein | +Inquiry |
INSL3-4101H | Recombinant Human INSL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
IL16-29736TH | Native Human IL16 | +Inquiry |
IgY-005C | Native Chicken IgY Ig Fraction | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
KGFLP1-357HCL | Recombinant Human KGFLP1 lysate | +Inquiry |
DEPDC1B-223HCL | Recombinant Human DEPDC1B lysate | +Inquiry |
SLC35A4-1733HCL | Recombinant Human SLC35A4 293 Cell Lysate | +Inquiry |
TLE4-1785HCL | Recombinant Human TLE4 cell lysate | +Inquiry |
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AF_2058 Products
Required fields are marked with *
My Review for All AF_2058 Products
Required fields are marked with *
0
Inquiry Basket