Recombinant Full Length Archaeoglobus Fulgidus Uncharacterized Protein Af_2048 (Af_2048) Protein, His-Tagged
Cat.No. : | RFL932AF |
Product Overview : | Recombinant Full Length Archaeoglobus fulgidus Uncharacterized protein AF_2048 (AF_2048) Protein (O28231) (1-307aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Archaeoglobus fulgidus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-307) |
Form : | Lyophilized powder |
AA Sequence : | MAKQMEKKSARLLAFLLALIMIGSVFAYMLSGGSAEHREVVYRLDDFREYVNWTPADPVY VQYYNLSYTSKLGSKDPLASMVTTDLQKLLIPAIFSRQVLEVTRGISQVMIVDFGETVPL YFVDAGMSKIYFAKEDEIKHGNFTLQVRRPGIALVSELSPLVVGYKPLVEKAVDTVEGNY PSFGNKTYSYLSRINGSFAYAFFAYGDVVKQWIRVGNESPADFFFEGYRYNFNNSSYEKV WAMHFEGNYFFGGMNESEKNFEYYKVQNFGDGLSVAVMEDKNFTKVVNARPNILTWQISF NNTQNES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AF_2048 |
Synonyms | AF_2048; Uncharacterized protein AF_2048 |
UniProt ID | O28231 |
◆ Recombinant Proteins | ||
UGT78D1-2557A | Recombinant Arabidopsis Thaliana UGT78D1 Protein (1-453 aa), His-tagged | +Inquiry |
PCDH2G4-2969Z | Recombinant Zebrafish PCDH2G4 | +Inquiry |
FABP7-26319TH | Recombinant Human FABP7 | +Inquiry |
SE0924-2877S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0924 protein, His-tagged | +Inquiry |
BTG1-404R | Recombinant Rhesus Macaque BTG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1846S | Active Native Soybean Agglutinin Protein, Biotinylated | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
Collagen Type I-11M | Native Mouse Collagen Type I Protein | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
Ferritin-12H | Native Human Ferritin Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR61-5781HCL | Recombinant Human GPR61 293 Cell Lysate | +Inquiry |
BCL2L15-8483HCL | Recombinant Human BCL2L15 293 Cell Lysate | +Inquiry |
PITX2-3165HCL | Recombinant Human PITX2 293 Cell Lysate | +Inquiry |
C1orf43-97HCL | Recombinant Human C1orf43 lysate | +Inquiry |
DUSP14-6781HCL | Recombinant Human DUSP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All AF_2048 Products
Required fields are marked with *
My Review for All AF_2048 Products
Required fields are marked with *
0
Inquiry Basket