Recombinant Full Length Arabidopsis Thaliana Upf0496 Protein At5G66660(At5G66660) Protein, His-Tagged
Cat.No. : | RFL8759AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UPF0496 protein At5g66660(At5g66660) Protein (Q9LVR4) (1-398aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-398) |
Form : | Lyophilized powder |
AA Sequence : | MEFCGCLSELMNGESSSKRNGPSTLPVKEVRTDMRSKYSSDLSSYTSACKKDSNLKSFDS SLHQRTNIIITSLAARAETQSLNLDSLMEVYGFLLELNQNAVRVIIESREDVWKNKDLKS LVDVYFKSTSKTLDFCNTVENCVKRTEISQLIIRFAVKQFEAESVDTDLGGDKKKKKYTK TLEELNKFKAMGDPFDGELVTQFDSVYDQQVLFLEELRKQRRKLDKKQRNVKTLRTVSNV FFATAYVSVLVLSVVATTMSAPPVVCAVASGSTAPIEITGKWFSQMWKKYEKAVKRQRGL VLTMESRVQVNNEAMKNIRSDVDELRSWVSSILETVDFAVEREEEEEAMGLAMQGIKKHV DGFTEKMEEVGENAAKCSKFIALGRLLVLEHILGLPAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At5g66660 |
Synonyms | At5g66660; MSN2.4; UPF0496 protein At5g66660 |
UniProt ID | Q9LVR4 |
◆ Recombinant Proteins | ||
LYZ-3196H | Recombinant Human LYZ protein, His-SUMO-tagged | +Inquiry |
ITPR2-463H | Recombinant Human ITPR2 | +Inquiry |
TMEM164-2101C | Recombinant Chicken TMEM164 | +Inquiry |
IL1RAP-305H | Recombinant Human IL1RAP Protein, Fc-tagged | +Inquiry |
TNFSF13B-933H | Recombinant Human TNFSF13B Protein, DDK/His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
GPOSP-40 | Active Native Glycerol-3-phosphate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
SF1-1922HCL | Recombinant Human SF1 293 Cell Lysate | +Inquiry |
Eye-643B | Bovine Eye Retina Lysate, Total Protein | +Inquiry |
GALNT14-6037HCL | Recombinant Human GALNT14 293 Cell Lysate | +Inquiry |
NPAS2-1208HCL | Recombinant Human NPAS2 cell lysate | +Inquiry |
ST6GAL2-1703HCL | Recombinant Human ST6GAL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At5g66660 Products
Required fields are marked with *
My Review for All At5g66660 Products
Required fields are marked with *
0
Inquiry Basket