Recombinant Full Length Arabidopsis Thaliana Upf0496 Protein At3G49070(At3G49070) Protein, His-Tagged
Cat.No. : | RFL304AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UPF0496 protein At3g49070(At3g49070) Protein (Q9SMU4) (1-416aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-416) |
Form : | Lyophilized powder |
AA Sequence : | MGIKVSSKIKRILASTGYIPIFIFKYRYYFYFFYCKFARKFVTKKIIILKLSSIGTASGS SNPKDGADVDVREEYANAFRTESYNHFWTRVVQLSRKKSAVSSSSSSPPIESSSTSARLM SYRLFAHNLLDPDLNTITRILDVSRVGRHTRTLLSDYFLETANAFLLCTQLLKNIHHLRS KYESLKPKFHSENHNSLALIDQFTEISKWFDPFISSGSRIQLIRSGCLYLLKRLESRRDK TRAKLKLINGLTHSSGLLVLALTTTLIVTIASHAFALFLAAPTLLASQFKPAGLRNKLTK TAARLDVAAKGTYILSRDLDTISRLVTRINDEVNHVRAMAEFWVGRGSGRVRGSEEVARE LKRCEESFSEELDELEEHIYLCFMTINRARNLLVKEILDSDDPPNCSFAPKSKKKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At3g49070 |
Synonyms | At3g49070; T2J13.90; UPF0496 protein At3g49070 |
UniProt ID | Q9SMU4 |
◆ Recombinant Proteins | ||
PECAM1-59H | Recombinant Human PECAM1, Fc-Tagged | +Inquiry |
GRAMD1A-7237M | Recombinant Mouse GRAMD1A Protein | +Inquiry |
AP2S1-358R | Recombinant Rat AP2S1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RTN4B-3764Z | Recombinant Zebrafish RTN4B | +Inquiry |
BLMH-242H | Recombinant Human BLMH Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
VTN-384B | Native Bovine Vitronectin | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
S100BB-10H | Native Human S100BB | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
OIT3-3587HCL | Recombinant Human OIT3 293 Cell Lysate | +Inquiry |
EGR2-6691HCL | Recombinant Human EGR2 293 Cell Lysate | +Inquiry |
KRTAP8-1-4839HCL | Recombinant Human KRTAP8 293 Cell Lysate | +Inquiry |
PROCR-1717MCL | Recombinant Mouse PROCR cell lysate | +Inquiry |
SOSTDC1-1567HCL | Recombinant Human SOSTDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At3g49070 Products
Required fields are marked with *
My Review for All At3g49070 Products
Required fields are marked with *
0
Inquiry Basket