Recombinant Full Length Arabidopsis Thaliana Upf0496 Protein At3G28310/At3G28320(At3G28310/At3G28320) Protein, His-Tagged
Cat.No. : | RFL5023AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UPF0496 protein At3g28310/At3g28320(At3g28310/At3g28320) Protein (Q6E240) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MAFSKDKTSRYSEHVDAYRAACGHHPDLKSFDSKIQQRTSNLIDSLTVEAKTGSVSPHAV HKEVIDIHLVEVSKAVADVITECGEEVWENGTLQSLVKDYFNSTMETLKIFETVTQCVHE AKRGQRYIKAAVAQFKKDSEEKDVGVKKKRYGKTLEELMKFKAMGNPFDDGLLKTQFELM NKQQESLFDRVTETKERIAKEIEEVQKRISNVNTATIVSHVVFGAAAFGYAAGCIALMCT GVGAPLGAGMVTLLPVIVVQWVGVNYVLNNSLEALQKQLKALNKVKPIPERITEGMEADK EGMKSVPEQVDELKDQISSLLQTVDDAIGSEGDEVDVKLDMESLEDDVKTLTTKITEVCE TVAKYSKIIKEARLHVLEKITGTG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At3g28310/At3g28320 |
Synonyms | At3g28310/At3g28320; MZF16.11/MZF16.13; UPF0496 protein At3g28310/At3g28320 |
UniProt ID | Q6E240 |
◆ Recombinant Proteins | ||
RAD54L-1549HFL | Recombinant Full Length Human RAD54L Protein, C-Flag-tagged | +Inquiry |
PDCD1LG2-1348H | Recombinant Human PDCD1LG2 Protein (Leu20-Thr220), N-His tagged | +Inquiry |
ITGAV&ITGB8-0165M | Active Recombinant Mouse ITGAV&ITGB8 protein, His-Avi-tagged, Biotinylated | +Inquiry |
RFL24043HF | Recombinant Full Length Human Protein Snorc(Snorc) Protein, His-Tagged | +Inquiry |
RFL34949HF | Recombinant Full Length Human Surfeit Locus Protein 4(Surf4) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
CAT-5276H | Native Human, Catalase | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
LDH4-23H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFRA1-961RCL | Recombinant Rat GFRA1 cell lysate | +Inquiry |
PRAMEF10-2894HCL | Recombinant Human PRAMEF10 293 Cell Lysate | +Inquiry |
LALBA-4829HCL | Recombinant Human LALBA 293 Cell Lysate | +Inquiry |
BLMH-8445HCL | Recombinant Human BLMH 293 Cell Lysate | +Inquiry |
SLC16A1-1802HCL | Recombinant Human SLC16A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At3g28310/At3g28320 Products
Required fields are marked with *
My Review for All At3g28310/At3g28320 Products
Required fields are marked with *
0
Inquiry Basket