Recombinant Full Length Arabidopsis Thaliana Upf0496 Protein At2G18630(At2G18630) Protein, His-Tagged
Cat.No. : | RFL22678AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UPF0496 protein At2g18630(At2g18630) Protein (Q56XQ0) (1-393aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-393) |
Form : | Lyophilized powder |
AA Sequence : | MMGGKSSKSKKNVEFGSPSTPVQIKINSEYTEHLSSYERACSEDPKLESFDSALHERTNR VINKLASGVEIKSLSFDSLREVTQCLLDMNQDVVKVILQDKEDIWNNQDLFSLVNLYFES TAKTMDFCSELENCLNRARRSQVIIQFAVNQFEEENEDKENRKYEKTLEELKRFKVAGEP FTKEFFALFDLVYKQQVMMLEELHKLKRKLDKRLRNIKTWRRVSNMVFVTAFVSVLIFSV VAAAVAAPPVVAAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGTYISVKE MDNISILVRKVEVEIESLLKKAEFAITEEKEVRLAIDEIKKKLDVFTETIEELGEHAGKY CSDVTKARTVILQRIIRYPAGSPKDEAPWTEMM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At2g18630 |
Synonyms | At2g18630; F24H14.1; MSF3.1; UPF0496 protein At2g18630 |
UniProt ID | Q56XQ0 |
◆ Recombinant Proteins | ||
CAND2-2684M | Recombinant Mouse CAND2 Protein | +Inquiry |
USO1-17897M | Recombinant Mouse USO1 Protein | +Inquiry |
Bmp2-565R | Recombinant Rat Bmp2 protein, His-tagged | +Inquiry |
RFL5759MF | Recombinant Full Length Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
CES2-1141H | Recombinant Human CES2, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Plg-5356M | Native Mouse Plg protein | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
FGG-26469TH | Native Human Fibrinogen protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
H293-01HL | Human 293, Transformed Primary Embryonal Kidney lysate | +Inquiry |
HMBS-5484HCL | Recombinant Human HMBS 293 Cell Lysate | +Inquiry |
NHSL2-1008HCL | Recombinant Human NHSL2 cell lysate | +Inquiry |
Liver-279H | Human Liver (LT Lobe) Membrane Lysate | +Inquiry |
RDH8-1489HCL | Recombinant Human RDH8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All At2g18630 Products
Required fields are marked with *
My Review for All At2g18630 Products
Required fields are marked with *
0
Inquiry Basket