Recombinant Full Length Arabidopsis Thaliana Uncharacterized Protein Pam68-Like(At5G52780) Protein, His-Tagged
Cat.No. : | RFL24658AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Uncharacterized protein PAM68-like(At5g52780) Protein (Q9LTD9) (1-168aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-168) |
Form : | Lyophilized powder |
AA Sequence : | MRALLCSHRLLPLSSLSRTTVKTKSHNPKTLYPNNKPRWESKLHAGPKGFQSSRTSEKPG RPDPDPEDDPPIPQEVFERMMGRIVVSVGTPLGLGVAILKVLEVLKDRNVWDVPLWVPYL TTLVTFGSSALGIAYGSLSTNLDPAKTNSLFGLKEAKENWVEMWKEDQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At5g52780 |
Synonyms | At5g52780; F6N7.27; Uncharacterized protein PAM68-like |
UniProt ID | Q9LTD9 |
◆ Recombinant Proteins | ||
IL4I1-1563HFL | Recombinant Full Length Human IL4I1 Protein, C-Flag-tagged | +Inquiry |
ITPKA-1222HFL | Recombinant Full Length Human ITPKA Protein, C-Flag-tagged | +Inquiry |
RFL15821PF | Recombinant Full Length Pan Paniscus Taste Receptor Type 2 Member 50(Tas2R50) Protein, His-Tagged | +Inquiry |
OGFOD1-10087Z | Recombinant Zebrafish OGFOD1 | +Inquiry |
MRPL53-4329C | Recombinant Chicken MRPL53 | +Inquiry |
◆ Native Proteins | ||
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
CGB-359H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
CPB-01P | Native Porcine Carboxypeptidase B | +Inquiry |
◆ Cell & Tissue Lysates | ||
Diaphragm-461C | Cat Diaphragm Lysate, Total Protein | +Inquiry |
TTC31-1855HCL | Recombinant Human TTC31 cell lysate | +Inquiry |
STK16-1408HCL | Recombinant Human STK16 293 Cell Lysate | +Inquiry |
NUDT15-3651HCL | Recombinant Human NUDT15 293 Cell Lysate | +Inquiry |
PLCB2-483HCL | Recombinant Human PLCB2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At5g52780 Products
Required fields are marked with *
My Review for All At5g52780 Products
Required fields are marked with *
0
Inquiry Basket