Recombinant Full Length Arabidopsis Thaliana Uncharacterized Membrane Protein At3G27390(At3G27390) Protein, His-Tagged
Cat.No. : | RFL5545AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Uncharacterized membrane protein At3g27390(At3g27390) Protein (Q8GUM4) (1-588aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-588) |
Form : | Lyophilized powder |
AA Sequence : | MEPPIGFRASLFQFLLFLPYFIGLLFLGFIKGIVLCPLVCLVVTIGNSAVILSLLPVHIV WTFYSIVSAKQVGPILKIFLCLCLPAAIILWPIVGILGSVLGGALYGFFSPIFATFDAVG EGKPYQFFHCFYDGTWSTMQRSFTVVRDFKDVCFHSYFSLMDELKQSCPDRKYYEIRLLQ LPGALVVSVLGILVDPPVISLVAICKSPYMLFKGWHRLFHDLIGREGPFLETMCVPIAGL AILLWPLAVTGAVIGSVISSIFLGAYAGVVSYQESSFYYGLCYIVASVSIYDEYSTDILD LPEGSCFPRPKYRRKDEEPTPFSGPVPRLGSVKNASSMRGGSVRVPMIDIKPLDLLNELF VECRRYGEVLATKGLINSKDIEEARSSKGSQVISVGLPAYGLLYEILRSVKANSSGLLLS DGVTEITTMNRPKDVFFDWFLNPFLILKEQMKATNLSEEEEEYLGRLVLLFGDPERLKSS NAISASPPLTERKRAELDAFARRMQGLTKTVSRYPTFRRHFVALVKKLSEDLDLKDNNSA KDESITEPPAPVKIISRIFSQRSFRRKGSVNGSDQESQKGVSRNVDIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At3g27390 |
Synonyms | At3g27390; K1G2.10; Uncharacterized membrane protein At3g27390 |
UniProt ID | Q8GUM4 |
◆ Native Proteins | ||
LDH2-19H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
ENO2-8235H | Native Human Brain Neuron Specific Enolase | +Inquiry |
TG-121B | Native Bovine TG | +Inquiry |
Lectin-1717U | Native Ulex europaeus Lectin | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDH3G-5302HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
Ventricle-231H | Human Heart: Ventricle (LT) Membrane Lysate | +Inquiry |
UCP2-525HCL | Recombinant Human UCP2 293 Cell Lysate | +Inquiry |
CLMP-2191MCL | Recombinant Mouse CLMP cell lysate | +Inquiry |
PTPRF-1439HCL | Recombinant Human PTPRF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At3g27390 Products
Required fields are marked with *
My Review for All At3g27390 Products
Required fields are marked with *
0
Inquiry Basket