Recombinant Full Length Arabidopsis Thaliana Udp-Glucuronate 4-Epimerase 4(Gae4) Protein, His-Tagged
Cat.No. : | RFL11165AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UDP-glucuronate 4-epimerase 4(GAE4) Protein (O22141) (1-437aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-437) |
Form : | Lyophilized powder |
AA Sequence : | MSRLDDIPSSPGKFKMEKSSYLHRLRFQSSLTKFAFFSFFLLCLISLLFLRSPPSINPSS PSDPSRRSLRTNTYGGPAWEKRLRSSARIRTSTNNGITVLVTGAAGFVGTHVSAALKRRG DGVIGLDNFNDYYDPSLKRARRALLERSGIFIVEGDINDVELLRKLFKIVSFTHVMHLAA QAGVRYAMENPSSYVHSNIAGFVNLLEICKSVNPQPAIVWASSSSVYGLNTKVPFSEKDK TDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTKDILKGK SISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLRVFNLGNTSP VPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTTDLQTGLKKF VRWYLSYYSGDKKAAAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GAE4 |
Synonyms | GAE4; UGlcAE1; At2g45310; F4L23; UDP-glucuronate 4-epimerase 4; UDP-glucuronic acid epimerase 4; AtUGlcAE1 |
UniProt ID | O22141 |
◆ Recombinant Proteins | ||
EPCAM-185CAF555 | Recombinant Cynomolgus EPCAM Protein, DDDDK-tagged, Alexa Fluor 555 conjugated | +Inquiry |
RBFOX3-3626R | Recombinant Rhesus Macaque RBFOX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
VEZT-371H | Recombinant Human VEZT Protein, MYC/DDK-tagged | +Inquiry |
Hgf-8665MAF488 | Recombinant Mouse Hgf Protein, None-tagged, Alexa Fluor 488 conjugated | +Inquiry |
POR-846HFL | Recombinant Full Length Human POR Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
CTRC-1209B | Native Bovine Chymotrypsin C (Caldecrin) | +Inquiry |
HPX-207H | Native Human Hemopexin | +Inquiry |
Total RNA-01E | Native E. coli Total RNA | +Inquiry |
Troponin I-11H | Native Human Troponin I protein | +Inquiry |
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFU1-3843HCL | Recombinant Human NFU1 293 Cell Lysate | +Inquiry |
TMED5-1787HCL | Recombinant Human TMED5 cell lysate | +Inquiry |
PPIC-2973HCL | Recombinant Human PPIC 293 Cell Lysate | +Inquiry |
HA-002H1N1CL | Recombinant H1N1 HA cell lysate | +Inquiry |
TST-1849HCL | Recombinant Human TST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAE4 Products
Required fields are marked with *
My Review for All GAE4 Products
Required fields are marked with *
0
Inquiry Basket