Recombinant Full Length Arabidopsis Thaliana Squalene Synthase(Sqs1) Protein, His-Tagged
Cat.No. : | RFL24369AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Squalene synthase(SQS1) Protein (P53799) (1-410aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-410) |
Form : | Lyophilized powder |
AA Sequence : | MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYDTDWHYSCGTKEYKILMD QFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQEVETVDDYDEYCHYVAGLVGLGL SKLFLAAGSEVLTPDWEAISNSMGLFLQKTNIIRDYLEDINEIPKSRMFWPREIWGKYAD KLEDLKYEENTNKSVQCLNEMVTNALMHIEDCLKYMVSLRDPSIFRFCAIPQIMAIGTLA LCYNNEQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDKNDPNASKTLN RLEAVQKLCRDAGVLQNRKSYVNDKGQPNSVFIIMVVILLAIVFAYLRAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SQS1 |
Synonyms | SQS1; At4g34640; T4L20.220; Squalene synthase 1; SQS 1; SS 1; FPP:FPP farnesyltransferase 1; Farnesyl-diphosphate farnesyltransferase 1 |
UniProt ID | P53799 |
◆ Recombinant Proteins | ||
ACAA2-719H | Recombinant Human ACAA2 | +Inquiry |
AP2A1-347R | Recombinant Rhesus monkey AP2A1 Protein, His-tagged | +Inquiry |
SAP057A-042-1937S | Recombinant Staphylococcus aureus (strain: 3049, other: MSSA) SAP057A_042 protein, His-tagged | +Inquiry |
SS18-29991TH | Recombinant Human SS18 | +Inquiry |
AYP1020-RS01370-5136S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS01370 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Type II Collagen-01C | Native Chicken Type II Collagen | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
LDL-394H | Native Human Low Density Lipoprotein, Biotin labeled | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
CDA016 | Native Hepatitis B Surface Ag protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IgG4-1609HCL | Recombinant Human IgG4 cell lysate | +Inquiry |
ISY1-5142HCL | Recombinant Human ISY1 293 Cell Lysate | +Inquiry |
GSTO2-5710HCL | Recombinant Human GSTO2 293 Cell Lysate | +Inquiry |
IL17B-5244HCL | Recombinant Human IL17B 293 Cell Lysate | +Inquiry |
C15orf48-8263HCL | Recombinant Human C15orf48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SQS1 Products
Required fields are marked with *
My Review for All SQS1 Products
Required fields are marked with *
0
Inquiry Basket