Recombinant Full Length Arabidopsis Thaliana Rhodanese-Like Domain-Containing Protein 4, Chloroplastic(Str4) Protein, His-Tagged
Cat.No. : | RFL31958AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Rhodanese-like domain-containing protein 4, chloroplastic(STR4) Protein (Q9M158) (70-466aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (70-466) |
Form : | Lyophilized powder |
AA Sequence : | LTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLSQVLNKKPKS WGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYNGEDKPGFLK KLSLKFKDPENTTLYILDKFDGNSELVAELVALNGFKSAYAIKDGAEGPRGWLNSSLPWI EPKKTLSLDLSSLTDSISGVFGESSDGVSVALGVAAAAGLSVFAFTEIETILQLLGSAAL VQLAGKKLLFAEDRKQTLKQVDEFLNTKVAPKELVDELKEIGKALLPQSTSNKALPAPAT VTAEAESATATTTTVDKPVPEPETVAATTTTVDKPVPEPEPVPEPVPVPAIEAAVAAQVI TEPTETEAKPKPHSRPLSPYASYPDLKPPSSPMPSQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | STR4 |
Synonyms | STR4; TROL; At4g01050; F2N1.31; Rhodanese-like domain-containing protein 4, chloroplastic; Protein THYLAKOID RHODANESE-LIKE; Sulfurtransferase 4; AtStr4 |
UniProt ID | Q9M158 |
◆ Recombinant Proteins | ||
Epor-601R | Recombinant Rat Epor protein, His-tagged | +Inquiry |
MSGN1-10130M | Recombinant Mouse MSGN1 Protein | +Inquiry |
PPP1R3B-4285R | Recombinant Rat PPP1R3B Protein, His (Fc)-Avi-tagged | +Inquiry |
STAT3-2172H | Recombinant Human STAT3 | +Inquiry |
CD274-2142H | Recombinant Human CD274 Molecule, Fc Chimera | +Inquiry |
◆ Native Proteins | ||
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
TF-93R | Native Rat Transferrin | +Inquiry |
Collagen Type I-01B | Native Bovine Collagen Type I (Atelocollagen) Protein | +Inquiry |
COL6-116H | Native Human Collagen type VI | +Inquiry |
F2-5402P | Native Porcine Coagulation Factor II (thrombin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTBP1-7215HCL | Recombinant Human CTBP1 293 Cell Lysate | +Inquiry |
LZTFL1-4575HCL | Recombinant Human LZTFL1 293 Cell Lysate | +Inquiry |
PLEKHJ1-3111HCL | Recombinant Human PLEKHJ1 293 Cell Lysate | +Inquiry |
PTPRD-2678HCL | Recombinant Human PTPRD 293 Cell Lysate | +Inquiry |
METTL14-4358HCL | Recombinant Human METTL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All STR4 Products
Required fields are marked with *
My Review for All STR4 Products
Required fields are marked with *
0
Inquiry Basket