Recombinant Full Length Arabidopsis Thaliana Putative Receptor-Like Protein Kinase At1G80870(At1G80870) Protein, His-Tagged
Cat.No. : | RFL11022AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative receptor-like protein kinase At1g80870(At1g80870) Protein (Q9SAH3) (1-692aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-692) |
Form : | Lyophilized powder |
AA Sequence : | MPSRPNPTRPKLFHNRTKTLFLILTISSSLVIFFAILYFIYHLWISLLNRSRTIPFDVAA ASPLKLQLFTYKELKLATNDFDESNVIGKGGSGTVFRGITRDGKLFAVKRLDNLSIQTET EFQNELQILGGLKSSFLVTLLGYCVEKNHRFLIYEYMPNKSLQELLFNEDGDSCLNWERR FGIILDVAKALEFMHFGCDPPVIHGDIKPSNVLLDSEFRAKISDFGLSRVKVEGGYGVDL FSQELSGNFGGESTPQTAIGTPTHHEVDFALALQASSSSKNSRTSRNIKEMSLNSMSLAM DGETKGKEVSNDVVLSCEDHEFDQGKEMNLLSPNSVLDLGKGSKQWGRDWWWKQEGSGEL CSKDYVREWIGSQIDTANPDWDDDKKVITTPELGVSTRTIDKAEHRDESGLNESRFDTLE EKFAKEEISERKNKRSKNKKKKHRNMEEWWKEEEHQEEMNNKKKIGVLRIKFKNHLKFPH FRYCFRQKGENSVHDREGEAAGEFSFRRGWRRKSNSSSKKKKKNNNGSMGSEMWSGDLFS RELSSTTSMRGTLCYIAPEYGGGCCYLMEKGDIYSFGVLILVIVSGRRPLHVLASPMKLE KANLVSWCRQLAQSGNVLELVDEKLKDGYNKEEAGLCINLALACLQKAPELRPDVSEVVR ILRGEMDISSTAFEFSPSPPGKVYGSRSKRRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At1g80870 |
Synonyms | At1g80870; F23A5.23; Putative receptor-like protein kinase At1g80870 |
UniProt ID | Q9SAH3 |
◆ Recombinant Proteins | ||
RFL13082EF | Recombinant Full Length Edwardsiella Ictaluri Cardiolipin Synthase(Cls) Protein, His-Tagged | +Inquiry |
THOC5-5711R | Recombinant Rat THOC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDP-5353C | Recombinant Chicken NDP | +Inquiry |
MIS18A-1352H | Recombinant Human MIS18A Protein, His-tagged | +Inquiry |
SCNN1G-4932R | Recombinant Rat SCNN1G Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HP-193S | Native Swine Haptoglobin | +Inquiry |
Lectin-1763A | Active Native Agaricus bisporus lectin Protein, Agarose bound | +Inquiry |
Histone-53C | Native Calf Histone Protein | +Inquiry |
LH-9389B | Active Native Bovine LH Protein | +Inquiry |
LTF-312H | Native Human LTF protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPM-2515HCL | Recombinant Human CPM cell lysate | +Inquiry |
CDCA4-7643HCL | Recombinant Human CDCA4 293 Cell Lysate | +Inquiry |
DZIP3-6744HCL | Recombinant Human DZIP3 293 Cell Lysate | +Inquiry |
KATNA1-888HCL | Recombinant Human KATNA1 cell lysate | +Inquiry |
COTL1-7338HCL | Recombinant Human COTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All At1g80870 Products
Required fields are marked with *
My Review for All At1g80870 Products
Required fields are marked with *
0
Inquiry Basket