Recombinant Full Length Arabidopsis Thaliana Putative Magnesium Transporter Mrs2-9(Mrs2-9) Protein, His-Tagged
Cat.No. : | RFL606AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative magnesium transporter MRS2-9(MRS2-9) Protein (Q9LXD4) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MSIDSDVDPSEVSTAKRKPSRSWLLIDAAGNSTMLNVDSYAIIRRVHIYARDLRVFESSI SSPLSIRTREGAIVLNLEHIKVIITADEVLLREPLNENVIPVAKEFERRLGVENRERRGQ PDGKEDSGAEVDAEKDESPFEFRALEVALEAICSFLAARTTELEKSGYPALNELASKISN RNFGKVHKLKISMLTVRVQKVKDELQLWLEDDDDLGDLCLSRKIATTSSPVSDSDEQINS YPTSPTIGAKISRAKSHLVRSATVRGDDQNDVEEVEMLLEAHYMQIDRTLNKLAELREYL DDTEDYINFQLASSRNKLIEFEVIITAGSVCISVYSLVVGILSTNIPFSWNTKEHMFKWV VSATATLCAIFFVIIISYARYKKLVGN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-9 |
Synonyms | MRS2-9; At5g09710; F17I14.100; MTH16.16; Putative magnesium transporter MRS2-9 |
UniProt ID | Q9LXD4 |
◆ Recombinant Proteins | ||
ZNF3-117H | Recombinant Human ZNF3 protein, His-tagged | +Inquiry |
RFL29383CF | Recombinant Full Length Candida Albicans Protein Sey1(Sey1) Protein, His-Tagged | +Inquiry |
bar-5601S | Recombinant Streptomyces hygroscopicus bar protein, His-tagged | +Inquiry |
SP3-3509H | Recombinant Human SP3 protein, His-tagged | +Inquiry |
HGF-18H | Active Recombinant Human HGF Protein, Animal Free | +Inquiry |
◆ Native Proteins | ||
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
Hp-8155M | Native Mouse Serum Haptoglobin | +Inquiry |
Fxa-281B | Active Native Bovine Factor Xa | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
Y. enterocolitica-31 | Native Yersinia enterocolitica O:9 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC135-7779HCL | Recombinant Human CCDC135 293 Cell Lysate | +Inquiry |
HSDL2-820HCL | Recombinant Human HSDL2 cell lysate | +Inquiry |
TMEM42-1793HCL | Recombinant Human TMEM42 cell lysate | +Inquiry |
Ovary-354C | Cynomolgus monkey Ovary Membrane Lysate | +Inquiry |
DOK5-6845HCL | Recombinant Human DOK5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MRS2-9 Products
Required fields are marked with *
My Review for All MRS2-9 Products
Required fields are marked with *
0
Inquiry Basket