Recombinant Full Length Arabidopsis Thaliana Putative Cyclic Nucleotide-Gated Ion Channel 15(Cngc15) Protein, His-Tagged
Cat.No. : | RFL6196AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 15(CNGC15) Protein (Q9SL29) (1-678aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-678) |
Form : | Lyophilized powder |
AA Sequence : | MGYGNSRSVRFQEDQEVVHGGESGVKLKFKINGTQINNVKMMSKGKFLKAKVLSRVFSED LERVKTKILDPRGQTIRRWNKIFLIACLVSLFVDPLFFFLPVMRNEACITIGVRLEVVLT LIRSLADAFYIAQILIRFRTAYIAPPSRVFGRGELVIDSRKIAWRYLHKSFWIHLVAALP LPQVLIWIIIPNLRGSPMTNTKNVLRFIIIFQYVPRMFLIFPLSRQIIKATGVVTETAWA GAAYNLMLYMLASHVLGACWYLLAVERQEACWRHACNIEKQICQYRFFECRRLEDPQRNS WFEWSNITTICKPASKFYEFGIFGDAVTSTVTSSKFINKYFYCLWWGLKNLSSLGQNLAT STYAGEILFAIIIATLGLVLFALLIGNMQTYLQSTTMRLEEWRIRRTDTEQWMHHRQLPP ELRQAVRKYDQYKWLATRGVDEEALLISLPLDLRRDIKRHLCFDLVRRVPLFDQMDERML DAICERLKPALCTEGTFLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCLIGPGDFC GEELLTWALDPRPVVILPSSTRTVKAICEVEAFALKAEDLQFVASQFRRLHTKQLRHKFR FYSHQWRTWAACFIQAAWRRHRKRKYKTELRAKEEFHYRFEAATARLAVNGGKYTRSGSD SGMMSSIQKPVEPDFSSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNGC15 |
Synonyms | CNGC15; At2g28260; T3B23.7; Putative cyclic nucleotide-gated ion channel 15; Cyclic nucleotide- and calmodulin-regulated ion channel 15 |
UniProt ID | Q9SL29 |
◆ Recombinant Proteins | ||
NR3C2-3728R | Recombinant Rat NR3C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRK1-379H | Recombinant Human killer cell lectin-like receptor subfamily K, member 1, His-tagged | +Inquiry |
GPSM3-1784R | Recombinant Rhesus Macaque GPSM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NS5-1766H | Recombinant HCV/Genotype-2 NS5 Protein | +Inquiry |
Cxcl16-2095M | Recombinant Mouse Cxcl16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1842S | Active Native Solanum Tuberosum Lectin Protein, Biotinylated | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
UMOD-91P | Native Porcine UMOD | +Inquiry |
Brain-013H | Human Brain Lysate, Total Protein | +Inquiry |
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSX2IP-1700HCL | Recombinant Human SSX2IP cell lysate | +Inquiry |
HTR1E-5336HCL | Recombinant Human HTR1E 293 Cell Lysate | +Inquiry |
PPP6R2-1560HCL | Recombinant Human PPP6R2 cell lysate | +Inquiry |
Colon-88M | Mouse Colon Tissue Lysate | +Inquiry |
ATG101-8318HCL | Recombinant Human C12orf44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNGC15 Products
Required fields are marked with *
My Review for All CNGC15 Products
Required fields are marked with *
0
Inquiry Basket