Recombinant Full Length Arabidopsis Thaliana Putative Aluminum-Activated Malate Transporter 3(Almt3) Protein, His-Tagged
Cat.No. : | RFL736AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative aluminum-activated malate transporter 3(ALMT3) Protein (Q9LPQ8) (1-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-581) |
Form : | Lyophilized powder |
AA Sequence : | MAAPKLESFRRGSMFDGSFRRGSMFDGSFRQSMRDRLILQSRGYSNVNDDDKTSVRCCSY SYFSDKITGVVKKLKDVLVTAWEMGTADPRKMIFSAKMGLALTLTSILIFFKIPGLELSG HYLWAILTVVVIFEFSIGATFSKGCNRGLGTLSAGGLALGMSWISEMTGNWADVFNAASI FVVAFFATYAKLYPTMKPYEYGFRVFLLTYCYVIVSGYKTGEFMETAVSRFLLIALGASV GLIVNTCIYPIWAGEDLHNLVAKNFVNVATSLEGCVNGYLECVAYDTIPSRILVYEAVAE DPVYSGYRSAVQSTSQEDTLMSFASWEPPHGPYKSFRYPWALYVKVGGALRHCAIMVMAL HGCILSEIQAAEDRRREFRNELQRVGIEGAKVLRYIGESLKKMEKLNPIEDILYEIHQAA EELQSKIDKKSYLLVNAKNWEIGNRPRVRDLTDEQKISNLDSDLSRILAHKSQSEATLRP PKNWDDVTTAANLSSATMLPYLQSRTMIHKQPSWPSRISITPGSMLQPPLGEPGKMYESA SNLSLATFASLLIEFVARLENLVNAYDELSVKANFKEAVSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALMT3 |
Synonyms | ALMT3; At1g18420; F15H18.9; Putative aluminum-activated malate transporter 3; AtALMT3 |
UniProt ID | Q9LPQ8 |
◆ Recombinant Proteins | ||
RAB30-3743R | Recombinant Rhesus monkey RAB30 Protein, His-tagged | +Inquiry |
ADD2-337H | Recombinant Human ADD2 Protein, GST-tagged | +Inquiry |
ISG20L2-8327M | Recombinant Mouse ISG20L2 Protein | +Inquiry |
FLNC-301631H | Recombinant Human FLNC protein, GST-tagged | +Inquiry |
RGMB-14127M | Recombinant Mouse RGMB Protein | +Inquiry |
◆ Native Proteins | ||
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
calc1-8308S | Native Salmon calc1 | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
Collagen Type I-02M | Native Mouse Collagen Type I (Atelocollagen) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS6KA6-674HCL | Recombinant Human RPS6KA6 cell lysate | +Inquiry |
PIAS2-3204HCL | Recombinant Human PIAS2 293 Cell Lysate | +Inquiry |
ST3GAL2-1702HCL | Recombinant Human ST3GAL2 cell lysate | +Inquiry |
Eye-89M | Mouse Eye Tissue Lysate | +Inquiry |
Cecum-606R | Rat Cecum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALMT3 Products
Required fields are marked with *
My Review for All ALMT3 Products
Required fields are marked with *
0
Inquiry Basket