Recombinant Full Length Arabidopsis Thaliana Protein Too Many Mouths(Tmm) Protein, His-Tagged
Cat.No. : | RFL36316AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Protein TOO MANY MOUTHS(TMM) Protein (Q9SSD1) (24-496aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-496) |
Form : | Lyophilized powder |
AA Sequence : | FTVITSDSTAPSALIDGPQTGFTMTNDGARTEPDEQDAVYDIMRATGNDWAAAIPDVCRG RWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCDPQRSYVSESLTRLKHLKALFFYRCL GRAPQRIPAFLGRLGSSLQTLVLRENGFLGPIPDELGNLTNLKVLDLHKNHLNGSIPLSF NRFSGLRSLDLSGNRLTGSIPGFVLPALSVLDLNQNLLTGPVPPTLTSCGSLIKIDLSRN RVTGPIPESINRLNQLVLLDLSYNRLSGPFPSSLQGLNSLQALMLKGNTKFSTTIPENAF KGLKNLMILVLSNTNIQGSIPKSLTRLNSLRVLHLEGNNLTGEIPLEFRDVKHLSELRLN DNSLTGPVPFERDTVWRMRRKLRLYNNAGLCVNRDSDLDDAFGSKSGSTVRLCDAETSRP APSGTVQHLSREEDGALPDGATDVSSTSKSLGFSYLSAFFLVFPNFIFMLISS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMM |
Synonyms | TMM; RLP17; At1g80080; F18B13.16; Protein TOO MANY MOUTHS; Receptor-like protein 17; AtRLP17 |
UniProt ID | Q9SSD1 |
◆ Native Proteins | ||
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
Ferritin-181R | Native Rat Ferritin | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
S100A1B-9H | Native Human S100A1B | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ear-115R | Rabbit Ear Lysate | +Inquiry |
INO80E-5201HCL | Recombinant Human INO80E 293 Cell Lysate | +Inquiry |
BRK1-8055HCL | Recombinant Human C3orf10 293 Cell Lysate | +Inquiry |
CLEC7A-760HCL | Recombinant Human CLEC7A cell lysate | +Inquiry |
IL23R-1429CCL | Recombinant Cynomolgus IL23R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMM Products
Required fields are marked with *
My Review for All TMM Products
Required fields are marked with *
0
Inquiry Basket