Recombinant Full Length Arabidopsis Thaliana Protein Phosphatase 2C 57(Pph1) Protein, His-Tagged
Cat.No. : | RFL35666AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Protein phosphatase 2C 57(PPH1) Protein (P49599) (1-388aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-388) |
Form : | Lyophilized powder |
AA Sequence : | MALLRPHLHRFHSNTLRHSAYPSADAGGGLVVYPTYGRHRCSAIAIDAPSSLTGVTPIRW GYTSVQGFRDEMEDDIVIRSDAVDSFSYAAVFDGHAGSSSVKFLREELYKECVGALQAGS LLNGGDFAAIKEALIKAFESVDRNLLKWLEANGDEEDESGSTATVMIIRNDVSFIAHIGD SCAVLSRSGQIEELTDYHRPYGSSRAAIQEVKRVKEAGGWIVNGRICGDIAVSRAFGDIR FKTKKNDMLKKGVDEGRWSEKFVSRIEFKGDMVVATPDIFQVPLTSDVEFIILASDGLWD YMKSSDVVSYVRDQLRKHGNVQLACESLAQVALDRRSQDNISIIIADLGRTEWKNLPAQR QNVVVELVQAATTIGLVTVGIWMSSHLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PPH1 |
Synonyms | PPH1; PP2C57; TAP38; At4g27800; T27E11.40; Protein phosphatase 2C 57; AtPP2C57; Protein phosphatase 2C PPH1; PP2C PPH1; Thylakoid-associated phosphatase of 38 kDa |
UniProt ID | P49599 |
◆ Recombinant Proteins | ||
E2F6-1368R | Recombinant Rhesus monkey E2F6 Protein, His-tagged | +Inquiry |
PSMB3-3657R | Recombinant Rhesus monkey PSMB3 Protein, His-tagged | +Inquiry |
GPS2-5560HF | Recombinant Full Length Human GPS2 Protein, GST-tagged | +Inquiry |
EMG1-1288R | Recombinant Rhesus Macaque EMG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL23A-159M | Recombinant Mouse IL23A protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
COL6-116H | Native Human Collagen type VI | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
NADS-33 | Active Native NAD synthase | +Inquiry |
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
ALPI-8341C | Native Calf ALPI | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-517D | Dog Liver Lysate, Total Protein | +Inquiry |
MICB-2885HCL | Recombinant Human MICB cell lysate | +Inquiry |
KDELR1-5001HCL | Recombinant Human KDELR1 293 Cell Lysate | +Inquiry |
HOXB4-5423HCL | Recombinant Human HOXB4 293 Cell Lysate | +Inquiry |
MYOZ2-4001HCL | Recombinant Human MYOZ2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPH1 Products
Required fields are marked with *
My Review for All PPH1 Products
Required fields are marked with *
0
Inquiry Basket