Recombinant Full Length Arabidopsis Thaliana Protein Accumulation And Replication Of Chloroplasts 6, Chloroplastic(Arc6) Protein, His-Tagged
Cat.No. : | RFL27259AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic(ARC6) Protein (Q9FIG9) (68-801aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (68-801) |
Form : | Lyophilized powder |
AA Sequence : | ATLVSPPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRRAFEARVSKPPQFGFSDDALI SRRQILQAACETLSNPRSRREYNEGLLDDEEATVITDVPWDKVPGALCVLQEGGETEIVL RVGEALLKERLPKSFKQDVVLVMALAFLDVSRDAMALDPPDFITGYEFVEEALKLLQEEG ASSLAPDLRAQIDETLEEITPRYVLELLGLPLGDDYAAKRLNGLSGVRNILWSVGGGGAS ALVGGLTREKFMNEAFLRMTAAEQVDLFVATPSNIPAESFEVYEVALALVAQAFIGKKPH LLQDADKQFQQLQQAKVMAMEIPAMLYDTRNNWEIDFGLERGLCALLIGKVDECRMWLGL DSEDSQYRNPAIVEFVLENSNRDDNDDLPGLCKLLETWLAGVVFPRFRDTKDKKFKLGDY YDDPMVLSYLERVEVVQGSPLAAAAAMARIGAEHVKASAMQALQKVFPSRYTDRNSAEPK DVQETVFSVDPVGNNVGRDGEPGVFIAEAVRPSENFETNDYAIRAGVSESSVDETTVEMS VADMLKEASVKILAAGVAIGLISLFSQKYFLKSSSSFQRKDMVSSMESDVATIGSVRADD SEALPRMDARTAENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGL VYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEVFWS KSGWKITEGSVLAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARC6 |
Synonyms | ARC6; At5g42480; MDH9.18; Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic |
UniProt ID | Q9FIG9 |
◆ Recombinant Proteins | ||
DEFA25-4452M | Recombinant Mouse DEFA25 Protein | +Inquiry |
RFL8116HF | Recombinant Full Length Halobacterium Sp. Bacteriorhodopsin(Bop) Protein, His-Tagged | +Inquiry |
ARPC5A-9728Z | Recombinant Zebrafish ARPC5A | +Inquiry |
STAT3-1107H | Recombinant Human STAT3 protein, His-tagged | +Inquiry |
SLC25A15-31413TH | Recombinant Human SLC25A15, T7 -tagged | +Inquiry |
◆ Native Proteins | ||
VCL-899T | Native Turkey VCL Protein | +Inquiry |
COL6-116H | Native Human Collagen type VI | +Inquiry |
Lectin-1721P | Native Peanut Lectin | +Inquiry |
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
ABL1-618H | Native Human C-abl Oncogene 1, Receptor Tyrosine Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cartilage-605R | Rat Cartilage Lysate, Total Protein | +Inquiry |
RNF130-2299HCL | Recombinant Human RNF130 293 Cell Lysate | +Inquiry |
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
HeLa-13H | HeLa Cell Nuclear Extract - Nocodozole Stimulated | +Inquiry |
PRMT7-2838HCL | Recombinant Human PRMT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARC6 Products
Required fields are marked with *
My Review for All ARC6 Products
Required fields are marked with *
0
Inquiry Basket