Recombinant Full Length Arabidopsis Thaliana Probable S-Acyltransferase At5G41060(At5G41060) Protein, His-Tagged
Cat.No. : | RFL30604AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable S-acyltransferase At5g41060(At5g41060) Protein (Q9FLM3) (1-410aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-410) |
Form : | Lyophilized powder |
AA Sequence : | MYVVTPPQRSGFGSDCDLRVYQTWKGSNIFCLQGRFIFGPDVRSLGLTISLIVAPVTIFC IFVASKLMDDFSDSWGVSIILVAVVFTIYDLILLMLTSGRDPGIIPRNSHPPEPEVVDGN TGSGTSQTPRLPRVKEVEVNGKVFKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWV GQCIAQRNYRFFFMFVFSTTLLCVYVFAFCCVYIKKIKESEDISILKAMLKTPASIALIL YTFISTFFVGGLTCFHLYLISTNQTTYENFRYSYDRHSNPHNKGVVDNFKEIFFSPIPPS KNNFRAMVPRENPMPSRSVVGGFMSPNMGKANDDIEMGRKGVWAMAEHGDGKDGNNNERF HVNDNELNELSPDMGNIVNGDEQINRPNNHPRNANWEMSPEVMALSARRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAT06 |
Synonyms | PAT06; At5g41060; MEE6.13; Probable protein S-acyltransferase 6; Probable palmitoyltransferase At5g41060; Zinc finger DHHC domain-containing protein At5g41060 |
UniProt ID | Q9FLM3 |
◆ Recombinant Proteins | ||
FSTL4-3377M | Recombinant Mouse FSTL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFSD5-6201HF | Recombinant Full Length Human MFSD5 Protein, GST-tagged | +Inquiry |
ETFA-3516H | Recombinant Human ETFA Protein, GST-tagged | +Inquiry |
PTGS2-26360TH | Recombinant Human PTGS2, His-tagged | +Inquiry |
BIRC7-5722Z | Recombinant Zebrafish BIRC7 | +Inquiry |
◆ Native Proteins | ||
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
Calmodulin-016 | Native Calmodulin Protein | +Inquiry |
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
ppk-8320P | Native Propionibacterium shermanii ppk | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2CB-2927HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
PARVA-3426HCL | Recombinant Human PARVA 293 Cell Lysate | +Inquiry |
EIF4E2-6650HCL | Recombinant Human EIF4E2 293 Cell Lysate | +Inquiry |
PPP1R1B-2939HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
FCN3-614HCL | Recombinant Human FCN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAT06 Products
Required fields are marked with *
My Review for All PAT06 Products
Required fields are marked with *
0
Inquiry Basket