Recombinant Full Length Arabidopsis Thaliana Probable S-Acyltransferase At1G69420(At1G69420) Protein, His-Tagged
Cat.No. : | RFL16877AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable S-acyltransferase At1g69420(At1g69420) Protein (Q9C533) (1-596aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-596) |
Form : | Lyophilized powder |
AA Sequence : | MRKHGWQLPYHPLQVVAVAVFLALGFAFYVFFAPFVGKKIHQYIAMGIYTPLITCVVGLY IWCAASDPADRGVFRSKKYLKIPENGKFPLAKDIKDGCGSATGGAKSHDGTCVEDTENGS NKKLESSERSSLLRLLCSPCALLCSCCSGKDESSEQMSEDGMFYCSLCEVEVFKYSKHCR VCDKCVDRFDHHCRWLNNCIGKRNYRKFFSLMVSAIFLLIMQWSTGIFVLVLCLLRRNQF NADIALKLGSSFSLIPFVIVVGVCTVLAMLATLPLAQLFFFHILLIKKGISTYDYIVALR EQEQELEAGGGQQSPQMSMISSFTGLSSASSFNTFHRGAWCTPPRLFLEDQFDVVPPENA SVSSYGKKSVVEERVKKKPQPVKISPWTLARLNAEEVSKAAAEARKKSKIIQPVARRENP FVGLEASSSFGSSGRRMFPTKYEGVNNNGKQRRQSKRIRLPAELPLEPLMNVQTKAAMET STSSGLAPLQLEARSAFQTSRAMSGSGNVMVTSSPESSLDSHDIHPFRVSSEAEDAAQLN GFSSAVGLMGQQRGQQQQQQLSMMMMPLSRSTSDGYDASGGEDSDQVPSRNIHKSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAT22 |
Synonyms | PAT22; At1g69420; F10D13.9; F23O10.1; Probable protein S-acyltransferase 22; Probable palmitoyltransferase At1g69420; Zinc finger DHHC domain-containing protein At1g69420 |
UniProt ID | Q9C533 |
◆ Recombinant Proteins | ||
CMTM5-1395H | Recombinant Human CMTM5 Protein, GST-tagged | +Inquiry |
LIX1-437H | Recombinant Human LIX1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
AMMECR1-151H | Recombinant Human AMMECR1 Protein, His-tagged | +Inquiry |
ARHGEF6-224R | Recombinant Rhesus Macaque ARHGEF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23326CF | Recombinant Full Length Chlorobium Phaeobacteroides Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
C3b-09R | Native Rat C3b Protein | +Inquiry |
RPE-425 | Native Red algae RPE | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
VCL tail-900T | Native Turkey VCL tail Protein | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spinal cord-464C | Cynomolgus monkey Spinal cord Membrane Lysate | +Inquiry |
Jejunum-253C | Cynomolgus monkey Jejunum Lysate | +Inquiry |
LRRN1-4619HCL | Recombinant Human LRRN1 293 Cell Lysate | +Inquiry |
CUL2-7184HCL | Recombinant Human CUL2 293 Cell Lysate | +Inquiry |
Lung-306H | Human Lung (LT Upper Lobe) Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAT22 Products
Required fields are marked with *
My Review for All PAT22 Products
Required fields are marked with *
0
Inquiry Basket