Recombinant Full Length Arabidopsis Thaliana Probable Mannan Synthase 10(Csla10) Protein, His-Tagged
Cat.No. : | RFL4013AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable mannan synthase 10(CSLA10) Protein (Q9LR87) (1-552aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-552) |
Form : | Lyophilized powder |
AA Sequence : | MTTFLKSLIFLQDSCLAFLSLMFHRGSSEDAAEALKKLETSINGARISFDTTWTREFRSL FIVPLFKCLVAFCLIISLLVFIEGIYMNLVVLYVKVFERKPEKVYRWEAMQEDIELGHET YPMVLVQIPMYNEKEVLQLSIGAACRLIWPLDRLIVQVLDDSTDQTIKELVNTECAKWES KGVNIKCERRDNRNGYKAGALKEGMKHNYVKLCNYVVIFDADFQPEPDYLQHSVPFLVHN PEVALVQARWRFMNANKCLMTRMQEMSLNYHFMAEQESGSTRHAFFSFNGTAGVWRMAAM EEAGGWHDRTTVEDMDLAVRAGLLGWKFVFLNDLTVKSELPSKFKAFRFQQHRWSCGPAN LFRKMIMEIIRNKRVTIWKKLYLVYSFFFLRKIIVHCFTFIFYCVILPTSVFFPEVNIPA WSTFYIPSMITLCIVIATPRSFYLVIFWILFENVMSMHRTKGTFIGILERQRVNEWVVTE KLGDALKTKLLPRIGKPSNMFLERVNSKEIMVGIYILCCACYGLFFGNTLLYLYLFMQAV AFLISGVGFVGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CSLA10 |
Synonyms | CSLA10; At1g24070; T23E23.23; Probable glucomannan 4-beta-mannosyltransferase 10; Cellulose synthase-like protein A10; AtCslA10; Glucomannan synthase; Mannan synthase 10 |
UniProt ID | Q9LR87 |
◆ Recombinant Proteins | ||
BRAF-174H | Recombinant Human BRAF protein, MYC/DDK-tagged | +Inquiry |
CRELD1-3328H | Recombinant Human CRELD1 Protein, MYC/DDK-tagged | +Inquiry |
SUJ-0012P2-2431S | Recombinant Staphylococcus aureus (strain: 18810) SUJ_0012P2 protein, His-tagged | +Inquiry |
Bag4-1818M | Recombinant Mouse Bag4 Protein, Myc/DDK-tagged | +Inquiry |
HN-4006N | Recombinant Newcastle disease virus HN protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
MV-01 | Native Measles Virus Antigen (Premium) | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
PF4-253H | Native Human Platelet Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf54-8365HCL | Recombinant Human C10orf54 293 Cell Lysate | +Inquiry |
SMAD4-1676HCL | Recombinant Human SMAD4 293 Cell Lysate | +Inquiry |
TMA16-8023HCL | Recombinant Human C4orf43 293 Cell Lysate | +Inquiry |
DENND5A-1456HCL | Recombinant Human DENND5A cell lysate | +Inquiry |
RSPO3-1906HCL | Recombinant Human RSPO3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSLA10 Products
Required fields are marked with *
My Review for All CSLA10 Products
Required fields are marked with *
0
Inquiry Basket