Recombinant Full Length Arabidopsis Thaliana Probable Isoprenylcysteine Alpha-Carbonyl Methylesterase Icmel2(Icmel2) Protein, His-Tagged
Cat.No. : | RFL7997AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2(ICMEL2) Protein (Q1PET6) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MQLSPERCRPMSENREAWSANSEEMELLHGSNRLSSPEHVRRRVSGNSSEDGSPRICRQQ SFGRDIGHAAAETYLITRLSFNLLGYLGVGYRWITRLLALACYAMLLMPGFLQVAYLYFF SSQVRRSIVYGGHPRNRLDLYIPPTSDGLKPVVVFVTGGAWIIGYKAWGSLLGLQLAERD IIVACLDYRNFPQGTISDMVSDAAQGISFVCNNISAFGGDPNRIYLMGQSAGAHISSCAL FEQAIKESRGESISWSVSQIKAYFGLSGGYNLFNLVEHFHNRGLYRSIFLSIMEGEESFK QFSPEVRLKDLNVRKAAALLPHIILFHGSADYSIPPEASKTFTDALQAAEVKAELVMYKG KTHTDLFLQDPLRGGKDELFDHIVSMIHADDSDALRNDAVAPPRKRLVPEFLLKLAGRVS PF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ICMEL2 |
Synonyms | ICMEL2; At3g02410; F16B3.4; Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2; Isoprenylcysteine methylesterase-like protein 2 |
UniProt ID | Q1PET6 |
◆ Recombinant Proteins | ||
CCL3-1213R | Recombinant Rat CCL3 Protein | +Inquiry |
ISOC1-4937Z | Recombinant Zebrafish ISOC1 | +Inquiry |
Efna4-10538M | Recombinant Mouse Efna4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC71-2923M | Recombinant Mouse CCDC71 Protein | +Inquiry |
MFSD6-2756R | Recombinant Rhesus monkey MFSD6 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TG-393H | Native Human Thyroglobulin | +Inquiry |
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
A2ML1-2105HCL | Recombinant Human A2ML1 cell lysate | +Inquiry |
CPB1-2423MCL | Recombinant Mouse CPB1 cell lysate | +Inquiry |
ENO2-6598HCL | Recombinant Human ENO2 293 Cell Lysate | +Inquiry |
RNH1-2266HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
OSTC-3522HCL | Recombinant Human OSTC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ICMEL2 Products
Required fields are marked with *
My Review for All ICMEL2 Products
Required fields are marked with *
0
Inquiry Basket