Recombinant Full Length Arabidopsis Thaliana Probable Inactive Receptor Kinase Rlk902(Rlk902) Protein, His-Tagged
Cat.No. : | RFL18626AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable inactive receptor kinase RLK902(RLK902) Protein (Q9LVI6) (30-647aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (30-647) |
Form : | Lyophilized powder |
AA Sequence : | DLAADKSALLSFRSAVGGRTLLWDVKQTSPCNWTGVLCDGGRVTALRLPGETLSGHIPEG IFGNLTQLRTLSLRLNGLTGSLPLDLGSCSDLRRLYLQGNRFSGEIPEVLFSLSNLVRLN LAENEFSGEISSGFKNLTRLKTLYLENNKLSGSLLDLDLSLDQFNVSNNLLNGSIPKSLQ KFDSDSFVGTSLCGKPLVVCSNEGTVPSQPISVGNIPGTVEGSEEKKKRKKLSGGAIAGI VIGCVVGLSLIVMILMVLFRKKGNERTRAIDLATIKHHEVEIPGEKAAVEAPENRSYVNE YSPSAVKAVEVNSSGMKKLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTL VAVKRLKDVTMADREFKEKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALL HGNKGAGRPPLNWEVRSGIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDF GLAQLVSASSTTPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEE GMDLARWVHSVAREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMV EVVRRIQELRQSGADRVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RLK902 |
Synonyms | RLK902; At3g17840; MEB5.6; Probable inactive receptor kinase RLK902; Receptor-like kinase 902 |
UniProt ID | Q9LVI6 |
◆ Recombinant Proteins | ||
FGF18-222H | Active Recombinant Human Fibroblast Growth Factor 18, HIgG1 Fc-tagged, mutant | +Inquiry |
SORT1B-6760Z | Recombinant Zebrafish SORT1B | +Inquiry |
ECE2-4152HF | Recombinant Full Length Human ECE2 Protein, GST-tagged | +Inquiry |
ACAN-140H | Recombinant Human ACAN Protein, GST-Tagged | +Inquiry |
RFL684NF | Recombinant Full Length Nicotiana Tabacum Probable Aquaporin Tip-Type Rb7-5A Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgG2-229H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
GOT-185H | Active Native Human Glutamate Oxaloacetate Tranasminase | +Inquiry |
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
IgG-159B | Native Bovine Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD99-1360RCL | Recombinant Rat CD99 cell lysate | +Inquiry |
SYT12-645HCL | Recombinant Human SYT12 lysate | +Inquiry |
NCI-H226-045WCY | Human Lung Squamous Cell Carcinoma NCI-H226 Whole Cell Lysate | +Inquiry |
FAM212A-8042HCL | Recombinant Human C3orf54 293 Cell Lysate | +Inquiry |
EFNB2-965CCL | Recombinant Canine EFNB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RLK902 Products
Required fields are marked with *
My Review for All RLK902 Products
Required fields are marked with *
0
Inquiry Basket