Recombinant Full Length Arabidopsis Thaliana Probable Inactive Receptor Kinase At1G27190 (At1G27190) Protein, His-Tagged
Cat.No. : | RFL10925AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable inactive receptor kinase At1g27190 (At1g27190) Protein (O04567) (25-601aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-601) |
Form : | Lyophilized powder |
AA Sequence : | EDDVLCLQGLKNSLIDPSSRLSSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQL AGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVEC KFLNALILSDNKLSGSIPSQLSRLDRLRRLSLAGNDLSGTIPSELARFGGDDFSGNNGLC GKPLSRCGALNGRNLSIIIVAGVLGAVGSLCVGLVIFWWFFIREGSRKKKGYGAGKSKDD SDWIGLLRSHKLVQVTLFQKPIVKIKLGDLMAATNNFSSGNIDVSSRTGVSYKADLPDGS ALAVKRLSACGFGEKQFRSEMNKLGELRHPNLVPLLGYCVVEDERLLVYKHMVNGTLFSQ LHNGGLCDAVLDWPTRRAIGVGAAKGLAWLHHGCQPPYLHQFISSNVILLDDDFDARITD YGLAKLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVASLKGDVYGFGIVLLELVTGQKP LSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICDKGHDEEILQFLKIACSCVVSRPK ERPTMIQVYESLKNMADKHGVSEHYDEFPLVFNKQEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At1g27190 |
Synonyms | At1g27190; T7N9.25; Probable inactive receptor kinase At1g27190 |
UniProt ID | O04567 |
◆ Recombinant Proteins | ||
DNMT3B-2198C | Recombinant Chicken DNMT3B | +Inquiry |
CFTR-0456H | Recombinant Human CFTR Protein (M1-L1480 end), eGFP, Strep II, 10×His tagged | +Inquiry |
DLX5-4638M | Recombinant Mouse DLX5 Protein | +Inquiry |
HLA-DRB4-1209H | Recombinant Human HLA-DRB4, GST-tagged | +Inquiry |
YLXX-4083B | Recombinant Bacillus subtilis YLXX protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
Lectin-1773E | Active Native Erythrina Cristagalli Lectin Protein, Biotinylated | +Inquiry |
HBA1-8158H | Native Hemoglobin A1C (HbA1c) | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPTE-830HCL | Recombinant Human TPTE 293 Cell Lysate | +Inquiry |
HOOK1-5435HCL | Recombinant Human HOOK1 293 Cell Lysate | +Inquiry |
OXTR-3502HCL | Recombinant Human OXTR 293 Cell Lysate | +Inquiry |
CRP-1945RCL | Recombinant Rat CRP cell lysate | +Inquiry |
CRY1-7269HCL | Recombinant Human CRY1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At1g27190 Products
Required fields are marked with *
My Review for All At1g27190 Products
Required fields are marked with *
0
Inquiry Basket