Recombinant Full Length Arabidopsis Thaliana Probable Cyclic Nucleotide-Gated Ion Channel 20, Chloroplastic(Cngc20) Protein, His-Tagged
Cat.No. : | RFL4141AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable cyclic nucleotide-gated ion channel 20, chloroplastic(CNGC20) Protein (Q9LD37) (26-764aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (26-764) |
Form : | Lyophilized powder |
AA Sequence : | AFTSRSRSVSLSNPTSSIEGFDTSTVVLGYTGPLRTQRRPPLVQMSGPLTSTRKHEPLFL PHPSSDSVGVSSQPERYPSFAALEHKNSSEDEFVLKHANLLRSGQLGMCNDPYCTTCPSY YNRKAAQIPTSRVSALFDSTFHNALYDDAKGWARRFASSVNRYLPGIMNPHAKEVQTWTK FFALSCLLAIFIDPLFFFLIKVQEQNKCIMIDWPMTKAFVAVRSVTDVIFTMNILLQFRL AYVARESTVVGAGQLVSHPKKIALHYLKGKFFLDLFIVMPLPQILILWIIPAHLGASGAN YAKNLLRAAVLFQYIPKLYRLLPFLAGQTPTGFIFESAWANFVINLLTFMLAGHVVGSCW YLFGLQRVNQCLRNACGNFGRECQDLIDCGNGNSSVLVRATWKDNASANACFQEDGFPYG IYLKAVNLTNHSNLFTRYSYSLFWGFQQISTLAGNQVPSYFLGEVFFTMGIIGLGLLLFA LLIGNMQNFLQALGKRNLEMTLRRRDVEQWMSHRRLPDGIRRRVREAERFNWAATRGVNE ELLFENMPDDLQRDIRRHLFKFLKKVRIFSLMDEPILDAIRERLKQRTYIGSSTVLHRGG LVEKMVFIVRGEMESIGEDGSVLPLYEGDVCGEELLTWCLERSSVNPDGTRIRMPSKGLL SSRNVRCVTNVEAFSLSVADLEDVTSLFSRFLRSHRVQGAIRYDSPYWRLRAARQIQVAW RYRRRRLHRLCTPQSSYSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNGC20 |
Synonyms | CNGC20; CNBT1; At3g17700; MKP6.28; Probable cyclic nucleotide-gated ion channel 20, chloroplastic; Cyclic nucleotide-binding transporter 1 |
UniProt ID | Q9LD37 |
◆ Recombinant Proteins | ||
SAP029A-025-2631S | Recombinant Staphylococcus aureus (strain: WB43S, other: ST73-MRSA-IVa (2B)) SAP029A_025 protein, His-tagged | +Inquiry |
C2orf40-10515H | Recombinant Human C2orf40, GST-tagged | +Inquiry |
FGF2-06B | Recombinant Bovine/Porcine FGF2 Protein | +Inquiry |
ENPP1-1414H | Recombinant Human ENPP1 protein, His-tagged | +Inquiry |
ANKRD29-2900Z | Recombinant Zebrafish ANKRD29 | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CACYBP-7898HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry |
THPO-2832HCL | Recombinant Human THPO cell lysate | +Inquiry |
MRPL22-4187HCL | Recombinant Human MRPL22 293 Cell Lysate | +Inquiry |
ITGA3-5134HCL | Recombinant Human ITGA3 293 Cell Lysate | +Inquiry |
Duodenum-610R | Rat Intestine, Duodenum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNGC20 Products
Required fields are marked with *
My Review for All CNGC20 Products
Required fields are marked with *
0
Inquiry Basket