Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 12(B3Galt12) Protein, His-Tagged
Cat.No. : | RFL721AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 12(B3GALT12) Protein (Q66GS2) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MPLFSHRFTTASSSSPASPSYYNKPSSKTHKPNSSSSSYTSSRIHVAIIFFSLVSVFIGV AGTIFALSSTGPASVYRCGGSKDTSRVVSASRKLGGDGGNNGVVVERRKLLGFVGIQTGF DSGDRRTALRSTWFPSDPDSLLRLEQATGLAFRFVIGKSKDAKKMAELEKEIKEYRDFVL LDTEEEYIRLPYKTLAFFKAAFKLFEADYYVKADDDIYLRPDRLATLLANERLHSQTYIG CMKKGPVITDPKLKWYEKQGNLIGNEYFLHAYGPIYVLSAEIVASLAAARNGSLRMFNNE DVTIGSWMLAMDVHHEDNRALCDPHCSPKSIAVWDIPKCSGLCDPESRLKELHKTDMCSK SPTLPPDDIDQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B3GALT12 |
Synonyms | B3GALT12; At2g26100; T19L18.9; Probable beta-1,3-galactosyltransferase 12 |
UniProt ID | Q66GS2 |
◆ Recombinant Proteins | ||
RBPJA-9867Z | Recombinant Zebrafish RBPJA | +Inquiry |
HSPH1-4370M | Recombinant Mouse HSPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP3K8-988H | Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase 8, GST-tagged | +Inquiry |
RFL11188HF | Recombinant Full Length Human G-Protein Coupled Receptor 157(Gpr157) Protein, His-Tagged | +Inquiry |
FKBP1A-2529H | Recombinant Human FKBP1A Protein (Gly2-Glu108), N-His tagged | +Inquiry |
◆ Native Proteins | ||
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
TFRC-69H | Native Human Apotransferrin | +Inquiry |
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
Muscles-833M | Mini pig S. Muscles Membrane Lysate, Total Protein | +Inquiry |
CD68-1362RCL | Recombinant Rat CD68 cell lysate | +Inquiry |
FGL1-6229HCL | Recombinant Human FGL1 293 Cell Lysate | +Inquiry |
SPRR3-1493HCL | Recombinant Human SPRR3 293 Cell Lysate | +Inquiry |
ZSCAN4-9184HCL | Recombinant Human ZSCAN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B3GALT12 Products
Required fields are marked with *
My Review for All B3GALT12 Products
Required fields are marked with *
0
Inquiry Basket