Recombinant Full Length Arabidopsis Thaliana Probable 3-Ketoacyl-Coa Synthase 2(Kcs2) Protein, His-Tagged
Cat.No. : | RFL27769AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable 3-ketoacyl-CoA synthase 2(KCS2) Protein (O65677) (1-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-487) |
Form : | Lyophilized powder |
AA Sequence : | MDANGGPVQIRTQNYVKLGYHYLITHFFKLMFLPLMAVLFMNVSLLSLNHLQLYYNSTGF IFVITLAIVGSIVFFMSRPRSIYLLDYSCYLPPSSQKVSYQKFMNNSSLIQDFSETSLEF QRKILIRSGLGEETYLPDSIHSIPPRPTMAAAREEAEQVIFGALDNLFENTKINPREIGV LVVNCSLFNPTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLASDMLQIHRNTFA LVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSNKPLDRKRSKYKLVHTVRTHKGS DENAFNCVYQEQDECLKTGVSLSKDLMAIAGEALKTNITSLGPLVLPISEQILFFATFVA KRLFNDKKKKPYIPDFKLALDHFCIHAGGRAVIDELEKSLKLSPKHVEASRMTLHRFGNT SSSSIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRNVEPSVNNPWEHCIHR YPVKIDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCS17 |
Synonyms | KCS17; KCS2; At4g34510; T4L20.90; 3-ketoacyl-CoA synthase 17; KCS-17; Very long-chain fatty acid condensing enzyme 17; VLCFA condensing enzyme 17 |
UniProt ID | O65677 |
◆ Native Proteins | ||
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
ACT-161R | Native rabbit ACT | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
FGB-6H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF484-2036HCL | Recombinant Human ZNF484 cell lysate | +Inquiry |
DEFB119-6985HCL | Recombinant Human DEFB119 293 Cell Lysate | +Inquiry |
PLAC1-3138HCL | Recombinant Human PLAC1 293 Cell Lysate | +Inquiry |
MPI-4235HCL | Recombinant Human MPI 293 Cell Lysate | +Inquiry |
GNAQ-5867HCL | Recombinant Human GNAQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KCS17 Products
Required fields are marked with *
My Review for All KCS17 Products
Required fields are marked with *
0
Inquiry Basket