Recombinant Full Length Arabidopsis Thaliana Palmitoyl-Monogalactosyldiacylglycerol Delta-7 Desaturase, Chloroplastic(Ads3) Protein, His-Tagged

• Cat.No.: RFL10117AF
• Product Overview: Recombinant Full Length Arabidopsis thaliana Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic(ADS3) Protein (Q949X0) (54-371aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Arabidopsis thaliana
• Source: E.coli
• Tag: His
• ProteinLength: Full Length of Mature Protein (54-371)
• Form: Lyophilized powder
• AA Sequence: AFSEKGLKRDVTTAAAATEGDYRRIMLSDVLVKKKEKVVWWEREWKAMDFGAVAVVLSMH LLSLLAPFQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQA LQGNPIDWVSTHRYHHQFCDSDRDPHSPLDGFWFSHMNWMFDTNTITQRCGEPNNVGDLE KQPFYRFLRTTYILHPLALAVALYAMGGFPFIVWGMGVRIVWVYHITWLVNSACHVWGKQ AWNTGDLSKNNWWVAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVKFLQAIGLAT DVKLPSEAQKQRMAFTSD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: ADS3
• Synonyms: ADS3; FAD5; FADB; At3g15850; MSJ11.25; Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic; Acyl-lipid desaturase 3; Fatty acid desaturase 5; Fatty acid desaturase B; Monogalactosyldiacylglycerol-specific palmitic acid desaturase
• UniProt ID: Q949X0