Recombinant Full Length Arabidopsis Thaliana Outer Envelope Protein 64, Chloroplastic(Oep64) Protein, His-Tagged
Cat.No. : | RFL23601AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Outer envelope protein 64, chloroplastic(OEP64) Protein (Q9LVH5) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MASQAANLWVLLGLGLAGILMLTKKLKKTVREDFGAFIDKLMLLPPPQPAPPKAPHPLTG LTFAVSDVFDITGYVTGFGHPDWVRTHEAASSTSPVVSTLVEGGATCVGKTVVDEFAFSI SGENKHYDSPTNPAAPTRIPGGACSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGF KSSYGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLQLPFATQRNPRQIILADDCF QLLKIPVDRITQVVTKSAEKLFGRQLLKHQNLETYFETKVPSLKEFARTKAIANTKVSTS RLLANVMQLLQRHEFLQNHGDWINTVKPAIDPVILSQVCENPELTNEETENLNAIRNETR VAIGSLLKDDGILVIPTLPAVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPLGH HEKCPISVSFIGRHGGDRFLLDTVQTMYPSLQEYSSIVTDPKSSKKAITKEESAEIAKEK GNQAFKEKLWQKAIGLYSEAIKLSDNNATYYSNRAAAYLELGGFLQAEEDCTKAITLDKK NVKAYLRRGTAREMLGDCKGAIEDFRYALVLEPNNKRASLSAERLRKFQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OEP64 |
Synonyms | OEP64; TOC64-III; At3g17970; MEB5.19; Outer envelope protein 64, chloroplastic; Translocon at the outer membrane of chloroplasts 64-III |
UniProt ID | Q9LVH5 |
◆ Recombinant Proteins | ||
CYP2AA4-324Z | Recombinant Zebrafish CYP2AA4 | +Inquiry |
RFL1270TF | Recombinant Full Length Tacaribe Virus Pre-Glycoprotein Polyprotein Gp Complex(Gpc) Protein, His-Tagged | +Inquiry |
CEP192-301434H | Recombinant Human CEP192 protein, GST-tagged | +Inquiry |
RSPO1-421H | Recombinant Human RSPO1 Protein, His-tagged | +Inquiry |
RFL17321SF | Recombinant Full Length Staphylococcus Aureus Antiholin-Like Protein Lrga(Lrga) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FBb-16H | Native Human FBb protein | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
Tenascin-112H | Native Human Tenascin | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
YPEL5-238HCL | Recombinant Human YPEL5 293 Cell Lysate | +Inquiry |
SAMHD1-2072HCL | Recombinant Human SAMHD1 293 Cell Lysate | +Inquiry |
DPPA4-6825HCL | Recombinant Human DPPA4 293 Cell Lysate | +Inquiry |
NADK2-8014HCL | Recombinant Human C5orf33 293 Cell Lysate | +Inquiry |
DDI1-452HCL | Recombinant Human DDI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OEP64 Products
Required fields are marked with *
My Review for All OEP64 Products
Required fields are marked with *
0
Inquiry Basket