Recombinant Full Length Arabidopsis Thaliana Mlo-Like Protein 14(Mlo14) Protein, His-Tagged
Cat.No. : | RFL7503AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana MLO-like protein 14(MLO14) Protein (Q94KB1) (1-554aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-554) |
Form : | Lyophilized powder |
AA Sequence : | MREETEPSERTLGLTPTWSVATVLTIFVFVSLIVERSIHRLSNWLQKTKRKPLFAALEKM KEELMLLGFISLLLTATSSTIANICVSSSFHNDRFVPCTPSEINEELESTISTVKRTQLT RSLFLHTLRRRLSGIGEDTCSEGHEPFLSYEGMEQLHRFIFIMAVTHVTYSCLTMLLAIV KIHRWRIWEDEVHMDRNDCLTVVAREKIFRRQTTFVQYHTSAPLVKNRLLIWVICFFRQF GHSVVRSDYLTLRKGFIMNHHLTLTYDFHSYMIRSMEEEFQKIVGVSGPLWGFVVGFMLF NIKGSNLYFWLAIIPITLVLLVGAKLQHVIATLALENASITEYASGIKLRPRDELFWFKK PELLLSLIHFIQFQNAFELASFFWFWWQFGYNSCFLRNHLLVYLRLILGFSGQFLCSYST LPLYALVTQMGTNYKAALLPQRVRETINGWGKATRRKRRHGLYGDDSTIRTETSTIASVD EYNDQVLDVSETSPVQDNELELQLIRGACGNSSSVETPILRPCASISSTTFSRLQTETTD SLSRSSSLPMRREC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MLO14 |
Synonyms | MLO14; At1g26700; T24P13.8; MLO-like protein 14; AtMlo14 |
UniProt ID | Q94KB1 |
◆ Recombinant Proteins | ||
LOC442028-5886HF | Recombinant Full Length Human LOC442028 Protein, GST-tagged | +Inquiry |
LRRC24-9258M | Recombinant Mouse LRRC24 Protein | +Inquiry |
MFRP-1249H | Recombinant Human MFRP Protein, MYC/DDK-tagged | +Inquiry |
DDT-1211R | Recombinant Rhesus monkey DDT Protein, His-tagged | +Inquiry |
RFL1157SF | Recombinant Full Length Streptococcus Pneumoniae Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
CAT-1187B | Native Bovine Catalase | +Inquiry |
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
HPX-84R | Native Rat Hemopexin | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIM2-4743HCL | Recombinant Human LIM2 293 Cell Lysate | +Inquiry |
Testis-508H | Human Testis Cytoplasmic Lysate | +Inquiry |
VPS39-1913HCL | Recombinant Human VPS39 cell lysate | +Inquiry |
TBX3-1199HCL | Recombinant Human TBX3 293 Cell Lysate | +Inquiry |
CENPJ-7583HCL | Recombinant Human CENPJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLO14 Products
Required fields are marked with *
My Review for All MLO14 Products
Required fields are marked with *
0
Inquiry Basket