Recombinant Full Length Arabidopsis Thaliana Mlo-Like Protein 13(Mlo13) Protein, His-Tagged
Cat.No. : | RFL5867AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana MLO-like protein 13(MLO13) Protein (Q94KB2) (1-478aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-478) |
Form : | Lyophilized powder |
AA Sequence : | MAEARSGSLEYTPTWVVAFICFIIVLLSLLAERGLHHLGKCLKRRQQDALFEALQKLKEE LMLLGFISLMLTVSQAAIRHICVPPALVNNMFPCKKPLEEHHAPKSSHSIINNARHLLST GESPDHCAAKGQVPLVSVEALHQLHIFIFVLAVFHVIFCASTMVLGGARIQQWKHWEDWF KKRPSQKGTTRRGHHAHAHELFSANHEFFEMHAGGFWRRSVVISWVRSFFKQFYGSVTKS EYIALRQAFIMSHCRTNPSFDFHKYMLRTLEIDFKKVVSISWYLWLFVVVFLLLNVGGWN TYFWLSFLPLILLLMVGAKLEYIISSLALDVSEKRSRAEEAVITPSDELFWFHRPGIVLQ LIHFILFQNSFEIAFFFWILFTYGIHSCIMEKLGYLIPRLVMGVLVQVLCSYSTLPLYAL VTQMGSKFKKGIFDNVVQSTLEGWLEDTRNRGESTSEAHRIEMQPTTPESYNVQSENP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MLO13 |
Synonyms | MLO13; At4g24250; T22A6.80; MLO-like protein 13; AtMlo13; AtMlo20 |
UniProt ID | Q94KB2 |
◆ Recombinant Proteins | ||
SE0624-3283S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0624 protein, His-tagged | +Inquiry |
AGBL5-1222Z | Recombinant Zebrafish AGBL5 | +Inquiry |
SPHK1-741H | Active Recombinant Human SPHK1 Protein, Met & His-tagged | +Inquiry |
PGAM1-1661H | Recombinant Human PGAM1, His-tagged | +Inquiry |
GDF6A-7462Z | Recombinant Zebrafish GDF6A | +Inquiry |
◆ Native Proteins | ||
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
CAPN2-22P | Active Native Porcine CAPN2 protein | +Inquiry |
SHBG-8259H | Native Human Serum Sex Hormone Binding Globulin | +Inquiry |
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAPK2-7076HCL | Recombinant Human DAPK2 293 Cell Lysate | +Inquiry |
Spleen-477H | Human Spleen Membrane Tumor Lysate | +Inquiry |
UBXN4-537HCL | Recombinant Human UBXN4 293 Cell Lysate | +Inquiry |
ZMYND11-151HCL | Recombinant Human ZMYND11 293 Cell Lysate | +Inquiry |
GLA-2173HCL | Recombinant Human GLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLO13 Products
Required fields are marked with *
My Review for All MLO13 Products
Required fields are marked with *
0
Inquiry Basket