Recombinant Full Length Arabidopsis Thaliana Magnesium Transporter Mrs2-3(Mrs2-3) Protein, His-Tagged
Cat.No. : | RFL22165AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Magnesium transporter MRS2-3(MRS2-3) Protein (Q9LJN2) (1-484aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-484) |
Form : | Lyophilized powder |
AA Sequence : | MRGARPDEFNFSTNPSTPNTGQPTPTYPAGVGGGGGGRKKGVGVRTWLVLNSSGQSEPKE EGKHSIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLLLNSKD PSVSPFIDELQRRILCHHHATKPQEEQNSGGEPHTRVDPAQGEAGTEQSSGDQGSEAKKD AKQSLENQDGSKVLPFEFVALEACLEAASSSLEHEALRLELEAHPALDKLTSKISTLNLE RVRQIKSRLVAITGRVQKVRDELEHLLDDDEDMAEMYLTEKLAQKLEDSSNSSMNESDTF EVDLPQGDEDDRLPPEFASEANRDGRYLQANDAHELLMSTQSALSRNSRGTHTSSTRSAM TNKLDVEELEMLLEAYFVQIDGILNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT TATLVMSAFIAVAGVFGMNITIELFTDNKHGPSRFIWTVIGGSIGSICLYVGAIGWCKYK RLLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-3 |
Synonyms | MRS2-3; MGT4; At3g19640; MMB12.11; Magnesium transporter MRS2-3; Magnesium Transporter 4; AtMGT4 |
UniProt ID | Q9LJN2 |
◆ Native Proteins | ||
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
GHRH-37H | Active Native Human GHRH | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLPS-419HCL | Recombinant Human CLPS cell lysate | +Inquiry |
RET-1822HCL | Recombinant Human RET cell lysate | +Inquiry |
MRPL51-4158HCL | Recombinant Human MRPL51 293 Cell Lysate | +Inquiry |
SNIP1-1628HCL | Recombinant Human SNIP1 293 Cell Lysate | +Inquiry |
HPS5-5394HCL | Recombinant Human HPS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MRS2-3 Products
Required fields are marked with *
My Review for All MRS2-3 Products
Required fields are marked with *
0
Inquiry Basket