Recombinant Full Length Arabidopsis Thaliana Magnesium Transporter Mrs2-11, Chloroplastic(Mrs2-11) Protein, His-Tagged
Cat.No. : | RFL8884AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Magnesium transporter MRS2-11, chloroplastic(MRS2-11) Protein (Q058N4) (63-459aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (63-459) |
Form : | Lyophilized powder |
AA Sequence : | CFAKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKIDSSSSSSSSDSTS LGIREPVYEVVEVKATGAISTRKINRRQLLKSSGLRPRDIRSVDPSLFMTNSVPSLLVRE HAILLNLGSLRAIAMRDRVLIFDYNRRGGRAFVDTLMPRLNPRSMNGGPSMPFELEAVES ALISRIQRLEQRLMDIEPRVQALLEVLPNRLTADILEELRISKQRLVELGSRAGALRQML LDLLEDPHEIRRICIMGRNCTLRRGDDDLECTLPSDKLIAEEEEEEIEMLLENYLQRCES CHGQAERLLDSAKEMEDSIAVNLSSRRLEVSRFELLLQVGTFCVAVGALIAGIFGMNLRS YLEEQASAFWLTTGGIIIGAAVAFFLMYSYLSRRKIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-11 |
Synonyms | MRS2-11; GMN10; MGT10; At5g22830; MRN17.6; Magnesium transporter MRS2-11, chloroplastic; Magnesium Transporter 10; AtMGT10 |
UniProt ID | Q058N4 |
◆ Native Proteins | ||
B. garinii-22 | Native Borrelia garinii Antigen | +Inquiry |
Neuraminidase-007C | Active Native Clostridium perfringens Neuraminidase, Type X | +Inquiry |
F10-302R | Native Rat Factor X | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPGS2-8223HCL | Recombinant Human C18orf10 293 Cell Lysate | +Inquiry |
SLC3A2-2015HCL | Recombinant Human SLC3A2 cell lysate | +Inquiry |
NCL-1174HCL | Recombinant Human NCL cell lysate | +Inquiry |
MTRF1-4067HCL | Recombinant Human MTRF1 293 Cell Lysate | +Inquiry |
SOCS2-1581HCL | Recombinant Human SOCS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-11 Products
Required fields are marked with *
My Review for All MRS2-11 Products
Required fields are marked with *
0
Inquiry Basket