Recombinant Full Length Arabidopsis Thaliana Isoprenylcysteine Alpha-Carbonyl Methylesterase Icme(Icme) Protein, His-Tagged
Cat.No. : | RFL21412AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Isoprenylcysteine alpha-carbonyl methylesterase ICME(ICME) Protein (Q94AS5) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MHSPLQTQQPEQRCWPMTSTVSEIEEVLPDEDSDRTTLLNGEPLRRRVSGKSPVDEGPRR IFRQQSFGRDIGHAAAETYLITGLSFKLLRYLGVGYRWMTKLLALTCYAMLLMPGFLQVA YSYFFSKQVRRSIVYGDQPRNRLDLYLPSNNDGLKPVVVFVTGGAWIIGYKAWGSLLGMQ LAERDIIVACLDYRNFPQGTISDMVTDASQGISFVCNNISAFGGDPNRIYLMGQSAGAHI AACALLEQATKELKGESISWTVSQIKAYFGLSGGYNLYKLVDHFHNRGLYRSIFLSIMEG EESFEKFSPEVRLKDPVVGKAASLLPPIILFHGSSDYSIPCDESKTFTDALQAVGAKAEL VLYSGKTHTDLFLQDPLRGGKDELFDDIVSVIHAEDNDGLTKDSLAPPRKRLVPELLLKL AREISPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ICME |
Synonyms | ICME; PCME; At5g15860; F14F8.240; Isoprenylcysteine alpha-carbonyl methylesterase ICME; Isoprenylcysteine methylesterase; Prenylcysteine methylesterase; AtPCME |
UniProt ID | Q94AS5 |
◆ Recombinant Proteins | ||
FUT7-01H | Active Recombinant Human FUT7 Protein, His-tagged | +Inquiry |
RFL4587RF | Recombinant Full Length Rat Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
ABHD12-1123M | Recombinant Mouse ABHD12 Protein | +Inquiry |
SLC35F3A-6252Z | Recombinant Zebrafish SLC35F3A | +Inquiry |
COX4I1-2003HF | Recombinant Full Length Human COX4I1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA7-8269H | Native Human Serum Thyroxine Binding Globulin | +Inquiry |
KRT19-40H | Native Human KRT19 protein | +Inquiry |
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
Fixa-279B | Active Native Bovine Factor IXa - EGR | +Inquiry |
LDL-404H | Native Human Low Density Lipoprotein, Oxidized, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FMO2-6183HCL | Recombinant Human FMO2 293 Cell Lysate | +Inquiry |
SW480-1728H | SW480 (Human colon adenocarcinoma) whole cell lysate | +Inquiry |
TMEM182-981HCL | Recombinant Human TMEM182 293 Cell Lysate | +Inquiry |
ICA1-5315HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
DAAM1-2111HCL | Recombinant Human DAAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ICME Products
Required fields are marked with *
My Review for All ICME Products
Required fields are marked with *
0
Inquiry Basket