Recombinant Full Length Arabidopsis Thaliana Iaa-Alanine Resistance Protein 1(Iar1) Protein, His-Tagged
Cat.No. : | RFL11269AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana IAA-alanine resistance protein 1(IAR1) Protein (Q9M647) (29-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (29-469) |
Form : | Lyophilized powder |
AA Sequence : | QSTPARDDHVHHHGGGCSHSHDHDHDHDHDHHVKKTTAKVEMKLPEELAEEEDMRLCGFG PCLHDHDHESSSTLTGFALWLNALGCSLLVSLASLICLVLLPIMFVQGKPSKWFVDSLAL FGAGAMLGDAFLHQLPHAFGGGHSHSNDHHENHDHHDHSHSDSPSHSHSIQDLSVGLSVL AGIVVFLLVEKLVRYVEENSSGSNTWGHHHHHHHAGSKKLKDEGDHNNLDQQSSSDAIVN SSEKVSGGSTDKSLRKRKTSASDATDKSDSGTEITSDGKSDKPEQVETRSSSLVFGYLNL FSDGVHNFTDGMALGSAFLIYGSVGGWSRTMFLLAHELPQEIGDFGILVRSGFTVTKALF FNFLSALVALAGTALVLVWGNEPGQSSLIEGFTAGGFIYIAVAGVLAEMNNSGKSTLKNS ACHLISLILGMSVALCISLIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IAR1 |
Synonyms | IAR1; At1g68100; T23K23.5; IAA-alanine resistance protein 1 |
UniProt ID | Q9M647 |
◆ Recombinant Proteins | ||
PPP1R18-7012M | Recombinant Mouse PPP1R18 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGFBP4-5924C | Recombinant Chicken IGFBP4 | +Inquiry |
Ppfibp1-5036M | Recombinant Mouse Ppfibp1 Protein, Myc/DDK-tagged | +Inquiry |
EPHA3-8547HAF647 | Recombinant Human EPHA3 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
ARPC3-7591H | Recombinant Human ARPC3, His-tagged | +Inquiry |
◆ Native Proteins | ||
Plasminogen-87H | Native Human Plasminogen | +Inquiry |
DES-167C | Native chicken DES | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYO6-4006HCL | Recombinant Human MYO6 293 Cell Lysate | +Inquiry |
BAI3-8523HCL | Recombinant Human BAI3 293 Cell Lysate | +Inquiry |
SNRNP40-1622HCL | Recombinant Human SNRNP40 293 Cell Lysate | +Inquiry |
ZNF471-2032HCL | Recombinant Human ZNF471 cell lysate | +Inquiry |
H3F3B-5653HCL | Recombinant Human H3F3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IAR1 Products
Required fields are marked with *
My Review for All IAR1 Products
Required fields are marked with *
0
Inquiry Basket