Recombinant Full Length Arabidopsis Thaliana Glycerol-3-Phosphate Acyltransferase 5(Gpat5) Protein, His-Tagged
Cat.No. : | RFL24183AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Glycerol-3-phosphate acyltransferase 5(GPAT5) Protein (Q9CAY3) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MVMEQAGTTSYSVVSEFEGTILKNADSFSYFMLVAFEAAGLIRFAILLFLWPVITLLDVF SYKNAALKLKIFVATVGLREPEIESVARAVLPKFYMDDVSMDTWRVFSSCKKRVVVTRMP RVMVERFAKEHLRADEVIGTELIVNRFGFVTGLIRETDVDQSALNRVANLFVGRRPQLGL GKPALTASTNFLSLCEEHIHAPIPENYNHGDQQLQLRPLPVIFHDGRLVKRPTPATALII LLWIPFGIILAVIRIFLGAVLPLWATPYVSQIFGGHIIVKGKPPQPPAAGKSGVLFVCTH RTLMDPVVLSYVLGRSIPAVTYSISRLSEILSPIPTVRLTRIRDVDAAKIKQQLSKGDLV VCPEGTTCREPFLLRFSALFAELTDRIVPVAMNYRVGFFHATTARGWKGLDPIFFFMNPR PVYEITFLNQLPMEATCSSGKSPHDVANYVQRILAATLGFECTNFTRKDKYRVLAGNDGT VSYLSLLDQLKKVVSTFEPCLH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPAT5 |
Synonyms | GPAT5; At3g11430; F24K9.10; Glycerol-3-phosphate acyltransferase 5; AtGPAT5 |
UniProt ID | Q9CAY3 |
◆ Recombinant Proteins | ||
SUMO2-734C | Recombinant Cynomolgus Monkey SUMO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTAP5-7-1584H | Recombinant Human KRTAP5-7 | +Inquiry |
MAPK8-1137H | Recombinant Human MAPK8 Protein (S2-E364), His tagged | +Inquiry |
CACNB4-0274H | Recombinant Human CACNB4 Protein, GST-Tagged | +Inquiry |
METAP1-2823C | Recombinant Chicken METAP1 | +Inquiry |
◆ Native Proteins | ||
GHRH-37H | Active Native Human GHRH | +Inquiry |
C6-101H | Native Human C6 Protein | +Inquiry |
LDH5-8342H | Native Human LDH5 | +Inquiry |
Lipoxidase-37S | Active Native Soybean Lipoxidase | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF8-6234HCL | Recombinant Human FGF8 293 Cell Lysate | +Inquiry |
LRRC18-4646HCL | Recombinant Human LRRC18 293 Cell Lysate | +Inquiry |
PSMB1-2775HCL | Recombinant Human PSMB1 293 Cell Lysate | +Inquiry |
PAK1-1275HCL | Recombinant Human PAK1 cell lysate | +Inquiry |
CCDC107-148HCL | Recombinant Human CCDC107 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPAT5 Products
Required fields are marked with *
My Review for All GPAT5 Products
Required fields are marked with *
0
Inquiry Basket