Recombinant Full Length Arabidopsis Thaliana Glycerol-3-Phosphate Acyltransferase 1(Gpat1) Protein, His-Tagged
Cat.No. : | RFL30801AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Glycerol-3-phosphate acyltransferase 1(GPAT1) Protein (Q9SHJ5) (1-585aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-585) |
Form : | Lyophilized powder |
AA Sequence : | MVLPELLVILAEWVLYRLLAKSCYRAARKLRGYGFQLKNLLSLSKTQSLHNNSQHHLHNH HQQNHPNQTLQDSLDPLFPSLTKYQELLLDKNRACSVSSDHYRDTFFCDIDGVLLRQHSS KHFHTFFPYFMLVAFEGGSIIRAILLLLSCSFLWTLQQETKLRVLSFITFSGLRVKDMDN VSRSVLPKFFLENLNIQVYDIWARTEYSKVVFTSLPQVLVERFLREHLNADDVIGTKLQE IKVMGRKFYTGLASGSGFVLKHKSAEDYFFDSKKKPALGIGSSSSPQDHIFISICKEAYF WNEEESMSKNNALPRERYPKPLIFHDGRLAFLPTPLATLAMFIWLPIGFLLAVFRISVGV FLPYHVANFLASMSGVRITFKTHNLNNGRPEKGNSGVLYVCNHRTLLDPVFLTTSLGKPL TAVTYSLSKFSEFIAPLKTVSLKRDRKKDGEAMQRLLSKGDLVVCPEGTTCREPYLLRFS PLFAELTEDIVPVAVDARVSMFYGTTASGLKCLDPIFFLMNPRPVYCLEILKKLPKEMTC AGGKSSFEVANFIQGELARVLGFECTNLTRRDKYLVLAGNEGIVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPAT1 |
Synonyms | GPAT1; At1g06520; F12K11.15; Glycerol-3-phosphate acyltransferase 1; AtGPAT1 |
UniProt ID | Q9SHJ5 |
◆ Recombinant Proteins | ||
ACOX3-1210M | Recombinant Mouse ACOX3 Protein | +Inquiry |
SIRPG-447H | Recombinant Human SIRPG Protein, Fc-tagged | +Inquiry |
SPRR1A-15929M | Recombinant Mouse SPRR1A Protein | +Inquiry |
UQCRH-5050C | Recombinant Chicken UQCRH | +Inquiry |
EIF3L-2714M | Recombinant Mouse EIF3L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1751A | Active Native Aleuria Aurantia Lectin Protein, Agarose bound | +Inquiry |
CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
FG-116H | Native Human Fibrinogen | +Inquiry |
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
F10-296M | Active Native Mouse Factor Xa | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
IL17C-5243HCL | Recombinant Human IL17C 293 Cell Lysate | +Inquiry |
HA-915HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
FMO1-282HCL | Recombinant Human FMO1 lysate | +Inquiry |
TCOF1-1170HCL | Recombinant Human TCOF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPAT1 Products
Required fields are marked with *
My Review for All GPAT1 Products
Required fields are marked with *
0
Inquiry Basket