Recombinant Full Length Arabidopsis Thaliana Ethylene Response Sensor 1(Ers1) Protein, His-Tagged
Cat.No. : | RFL24121AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Ethylene response sensor 1(ERS1) Protein (Q38846) (1-613aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-613) |
Form : | Lyophilized powder |
AA Sequence : | MESCDCFETHVNQDDLLVKYQYISDALIALAYFSIPLELIYFVQKSAFFPYKWVLMQFGA FIILCGATHFINLWMFFMHSKAVAIVMTIAKVSCAVVSCATALMLVHIIPDLLSVKNREL FLKKKADELDREMGLILTQEETGRHVRMLTHGIRRTLDRHTILRTTLVELGKTLCLEECA LWMPSQSGLYLQLSHTLSHKIQVGSSVPINLPIINELFNSAQAMHIPHSCPLAKIGPPVG RYSPPEVVSVRVPLLHLSNFQGSDWSDLSGKGYAIMVLILPTDGARKWRDHELELVENVA DQVAVALSHAAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMH AIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRLEDGSLLLENEPFSLQ AIFEEVISLIKPIASVKKLSTNLILSADLPTYAIGDEKRLMQTILNIMGNAVKFTKEGYI SIIASIMKPESLQELPSPEFFPVLSDSHFYLCVQVKDTGCGIHTQDIPLLFTKFVQPRTG TQRNHSGGGLGLALCKRFVGLMGGYMWIESEGLEKGCTASFIIRLGICNGPSSSSGSMAL HLAAKSQTRPWNW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERS1 |
Synonyms | ERS1; ERS; At2g40940; T20B5.14; Ethylene response sensor 1; AtERS1; Protein ERS1 |
UniProt ID | Q38846 |
◆ Recombinant Proteins | ||
SPSI-2160B | Recombinant Bacillus subtilis SPSI protein, His-tagged | +Inquiry |
CAPZA2-455R | Recombinant Rhesus Macaque CAPZA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGFLAM-5064HF | Recombinant Full Length Human EGFLAM Protein, GST-tagged | +Inquiry |
ApoE4-3563H | Recombinant Human ApoE4 | +Inquiry |
COPS7A-799R | Recombinant Rhesus Macaque COPS7A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
UBA52-140H | Native Bovine Ubiquitin, Biotinylated | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Histone-52C | Native Calf Histone | +Inquiry |
IBVF0406-225I | Native Influenza (B/Florida 04/06) IBVF0406 protein | +Inquiry |
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
POLDIP3-3049HCL | Recombinant Human POLDIP3 293 Cell Lysate | +Inquiry |
UBE2D3-586HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
SCARB1-2684MCL | Recombinant Mouse SCARB1 cell lysate | +Inquiry |
AGTPBP1-38HCL | Recombinant Human AGTPBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERS1 Products
Required fields are marked with *
My Review for All ERS1 Products
Required fields are marked with *
0
Inquiry Basket