Recombinant Full Length Arabidopsis Thaliana E3 Ubiquitin-Protein Ligase Atl4(Atl4) Protein, His-Tagged

• Cat.No.: RFL8896AF
• Product Overview: Recombinant Full Length Arabidopsis thaliana E3 ubiquitin-protein ligase ATL4(ATL4) Protein (Q9LY41) (1-334aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Arabidopsis thaliana
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-334)
• Form: Lyophilized powder
• AA Sequence: MESLINPSHGGGNYDSHSSSLDSLKPSVLVIILILLMTLLISVSICFLLRCLNRCSHRSV LPLSSSSSVATVTSDSRRFSGHRVSPETERSSVLDSLPIFKFSSVTRRSSSMNSGDCAVC LSKFEPEDQLRLLPLCCHAFHADCIDIWLVSNQTCPLCRSPLFASESDLMKSLAVVGSNN GGGENSFRLEIGSISRRRQTPIPESVEQHRTYSIGSFDYIVDDVDSEISESNFNRGKQED ATTTTATATAVTTNPTSFEASLAADIGNDGSRSWLKDYVDRLSRGISSRAMSFRSSGRFF TGSSRRSEELTVMDLEANHAGEEISELFRWLSGV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: ATL4
• Synonyms: ATL4; RHX1A; At3g60220; F27H5_10; E3 ubiquitin-protein ligase ATL4; Protein ARABIDOPSIS TOXICOS EN LEVADURA 4; Protein ATL4; RING-H2 finger X1a; RING-H2 zinc finger protein ATL4; RING-H2 zinc finger protein RHX1a; RING-type E3 ubiquitin transferase ATL4
• UniProt ID: Q9LY41