Recombinant Full Length Arabidopsis Thaliana Cyclic Nucleotide-Gated Ion Channel 2(Cngc2) Protein, His-Tagged
Cat.No. : | RFL20178AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Cyclic nucleotide-gated ion channel 2(CNGC2) Protein (O65718) (1-726aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-726) |
Form : | Lyophilized powder |
AA Sequence : | MPSHPNFIFRWIGLFSDKFRRQTTGIDENSNLQINGGDSSSSGSDETPVLSSVECYACTQ VGVPAFHSTSCDQAHAPEWRASAGSSLVPIQEGSVPNPARTRFRRLKGPFGEVLDPRSKR VQRWNRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVLRTCLDAVHLW HVWLQFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWLVV PKLIREEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLIAY FIASHVAGGCWYVLAIQRVASCIRQQCMRTGNCNLSLACKEEVCYQFVSPTSTVGYPCLS GNLTSVVNKPMCLDSNGPFRYGIYRWALPVISSNSLAVKILYPIFWGLMTLSTFANDLEP TSNWLEVIFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQLPS RLRQRVRRFERQRWNALGGEDELELIHDLPPGLRRDIKRYLCFDLINKVPLFRGMDDLIL DNICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRVKRIQSLSKGVLATSTLEPGGYLGD ELLSWCLRRPFLDRLPPSSATFVCLENIEAFSLGSEDLRYITDHFRYKFANERLKRTARY YSSNWRTWAAVNIQMAWRRRRKRTRGENIGGSMSPVSENSIEGNSERRLLQYAAMFMSIR PHDHLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNGC2 |
Synonyms | CNGC2; DND1; At5g15410; T20K14_20; Cyclic nucleotide-gated ion channel 2; AtCNGC2; Cyclic nucleotide- and calmodulin-regulated ion channel 2; Protein DEFENSE NO DEATH 1 |
UniProt ID | O65718 |
◆ Recombinant Proteins | ||
RFL17974HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 111(Gpr111) Protein, His-Tagged | +Inquiry |
RASA1-3433H | Recombinant Human RASA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mmp7-749R | Recombinant Rat Mmp7 protein, His & T7-tagged | +Inquiry |
PNMT-1440HFL | Recombinant Full Length Human PNMT Protein, C-Flag-tagged | +Inquiry |
NPL-11784Z | Recombinant Zebrafish NPL | +Inquiry |
◆ Native Proteins | ||
PLAU -14H | Native Human HMW urokinase, fluorescein labeled | +Inquiry |
HSV-1ag-265V | Active Native HSV-1 Protein | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
TF-01B | Native Bovine TF Protein | +Inquiry |
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-467C | Cat Lung Lysate, Total Protein | +Inquiry |
KIAA0195-4981HCL | Recombinant Human KIAA0195 293 Cell Lysate | +Inquiry |
WISP1-308HCL | Recombinant Human WISP1 293 Cell Lysate | +Inquiry |
STIP1-641HCL | Recombinant Human STIP1 lysate | +Inquiry |
GRAP-5758HCL | Recombinant Human GRAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNGC2 Products
Required fields are marked with *
My Review for All CNGC2 Products
Required fields are marked with *
0
Inquiry Basket