Recombinant Full Length Arabidopsis Thaliana Casp-Like Protein At1G03700(At1G03700) Protein, His-Tagged
Cat.No. : | RFL22243AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana CASP-like protein At1g03700(At1g03700) Protein (Q9LR57) (1-164aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-164) |
Form : | Lyophilized powder |
AA Sequence : | MVKLTQRLGGLVLRFAAFCAALGAVIAMITSRERSSFFVISLVAKYSDLAAFKYFVIANA IVTVYSFLVLFLPKESLLWKFVVVLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPIC GQVPRFCDQITGALIAGLVALVLYVFLLIFSIHHVVDPFLLRKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At1g03700 |
Synonyms | At1g03700; F21B7.30; CASP-like protein 1C2; AtCASPL1C2 |
UniProt ID | Q9LR57 |
◆ Native Proteins | ||
IgG-009H | Native Hamster Whole Molecule IgG, Biotin Conjugate | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
MFGE8-8518B | Native Bovine MFGE8, Fluoresence-labeled | +Inquiry |
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
THBS1-31515TH | Native Human THBS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PINK1-1352HCL | Recombinant Human PINK1 cell lysate | +Inquiry |
STBD1-694HCL | Recombinant Human STBD1 cell lysate | +Inquiry |
HGH1-257HCL | Recombinant Human HGH1 cell lysate | +Inquiry |
HLA-G-5493HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
PAEP-3469HCL | Recombinant Human PAEP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At1g03700 Products
Required fields are marked with *
My Review for All At1g03700 Products
Required fields are marked with *
0
Inquiry Basket