Recombinant Full Length Arabidopsis Thaliana Atp-Dependent Zinc Metalloprotease Ftsh 1, Chloroplastic(Ftsh1) Protein, His-Tagged
Cat.No. : | RFL36811AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 1, chloroplastic(FTSH1) Protein (Q39102) (87-716aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (87-716) |
Form : | Lyophilized powder |
AA Sequence : | VVDEPASPSVVIESQAVKPSTPSPLFIQNEILKAPSPKSSDLPEGSQWRYSEFLNAVKKG KVERVRFSKDGSVVQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESSGNDLFTV IGNLIFPLLAFGGLFLLFRRAQGGPGGGPGGLGGPMDFGRSKSKFQEVPETGVSFADVAG ADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLVGPPGTGKTLLARAVAGEAGVPFFSC AASEFVELFVGVGASRVRDLFEKAKSKAPCIVFIDEIDAVGRQRGAGMGGGNDEREQTIN QLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRFDRQVTVDRPDVAGRVKILQVHSR GKALGKDVDFDKVARRTPGFTGADLQNLMNEAAILAARRELKEISKDEISDALERIIAGP EKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLE SGLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKI GQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHK LAQLLIEKETVDGEEFMSLFIDGQAELYIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FTSH1 |
Synonyms | FTSH1; AAA; FTSH; At1g50250; F14I3.14; ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; AtFTSH1 |
UniProt ID | Q39102 |
◆ Recombinant Proteins | ||
NAA10-12519Z | Recombinant Zebrafish NAA10 | +Inquiry |
GK5-1863R | Recombinant Rhesus monkey GK5 Protein, His-tagged | +Inquiry |
Gls-3231M | Recombinant Mouse Gls Protein, Myc/DDK-tagged | +Inquiry |
CGA-224H | Recombinant Human CGA, StrepII-tagged | +Inquiry |
TRIM23-3408H | Recombinant Human TRIM23, GST-tagged | +Inquiry |
◆ Native Proteins | ||
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
HRP-8336h | Active Native horseradish HRP | +Inquiry |
MMP7-28205TH | Native Human MMP7 | +Inquiry |
Lectin-1801L | Active Native Lycopersicon Esculentum Lectin Protein, Biotinylated | +Inquiry |
LYZ-27700TH | Native Human LYZ | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASIC3-9100HCL | Recombinant Human ACCN3 293 Cell Lysate | +Inquiry |
FGR-6228HCL | Recombinant Human FGR 293 Cell Lysate | +Inquiry |
PARP1-514MCL | Recombinant Mouse PARP1 cell lysate | +Inquiry |
TBC1D28-1223HCL | Recombinant Human TBC1D28 293 Cell Lysate | +Inquiry |
CYTH2-7094HCL | Recombinant Human CYTH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FTSH1 Products
Required fields are marked with *
My Review for All FTSH1 Products
Required fields are marked with *
0
Inquiry Basket