Recombinant Full Length Arabidopsis Thaliana Aquaporin Nip6-1(Nip6-1) Protein, His-Tagged
Cat.No. : | RFL28129AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Aquaporin NIP6-1(NIP6-1) Protein (Q9SAI4) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MDHEEIPSTPSTPATTPGTPGAPLFGGFEGKRNGHNGRYTPKSLLKSCKCFSVDNEWALEDGRLPPVTCSLPPPNVSLYRKLGAEFVGTLILIFAGTATAIVNQKTDGAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVMASVSAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTIVKLPEEDEAPKERRSFRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NIP6-1 |
Synonyms | NIP6-1; At1g80760; F23A5.11; Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 |
UniProt ID | Q9SAI4 |
◆ Native Proteins | ||
Pepsin-41P | Active Native Porcine Pepsin | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
Spinal Cord-010H | Human Spinal Cord Lysate, Total Protein | +Inquiry |
IgG-353C | Native Chicken IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLTM-1641HCL | Recombinant Human SLTM cell lysate | +Inquiry |
TNFRSF1A-2390HCL | Recombinant Human TNFRSF1A cell lysate | +Inquiry |
PSG9-2783HCL | Recombinant Human PSG9 293 Cell Lysate | +Inquiry |
SNRPE-1613HCL | Recombinant Human SNRPE 293 Cell Lysate | +Inquiry |
AAK1-2106HCL | Recombinant Human AAK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NIP6-1 Products
Required fields are marked with *
My Review for All NIP6-1 Products
Required fields are marked with *
0
Inquiry Basket