Recombinant Full Length Arabidopsis Thaliana Ankyrin Repeat-Containing Protein At3G12360(At3G12360) Protein, His-Tagged
Cat.No. : | RFL1734AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Ankyrin repeat-containing protein At3g12360(At3g12360) Protein (Q9C7A2) (1-590aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-590) |
Form : | Lyophilized powder |
AA Sequence : | MAASSYVDGERDMEKGGMILLQSSENQNPMIDPSPTPSPSATATAPALVLSNSGKRMDQA GKKKYVKQVTGRHNDTELHLAAQRGDLAAVQQILKDINSQMEGILSGEEFDAEVAEIRAS IVNEVNELGETALFTAADKGHLDVVKELLKYSSRESIAKKNRSGYDPLHIAAIQGHHAIV EVLLDHDATLSQTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLEISRSNNKNALHLAA RQGHVEVIKALLSKDPQLARRIDKKGQTALHMAVKGQSSEVVKLLLDADPAIVMQPDKSC NTALHVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDIAEGLPLSEESSYIKECLARS GALRANELNQPRDELRSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKLHREGINNATN SVTVVAVLFATVAFAAIFTVPGGDNNDGSAVVVGRASFKIFFIFNALALFTSLAVVVVQI TLVRGETKAEKRVVEVINKLMWLASMCTSVAFLASSYIVVGRKNEWAAELVTVVGGVIMA GVLGTMTYYVVKSKRTRSMRKKVKSARRSGSNSWHHSDFSNSEVDPIFAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ITN1 |
Synonyms | ITN1; At3g12360; MQC3.17; T2E22.31; Ankyrin repeat-containing protein ITN1; Protein INCREASED TOLERANCE TO NACL |
UniProt ID | Q9C7A2 |
◆ Recombinant Proteins | ||
TRNP1-1796H | Recombinant Human TRNP1 | +Inquiry |
RFL16329MF | Recombinant Full Length Mouse Long-Chain Fatty Acid Transport Protein 3(Slc27A3) Protein, His-Tagged | +Inquiry |
GZMC-4027M | Recombinant Mouse GZMC Protein, His (Fc)-Avi-tagged | +Inquiry |
SE0664-3306S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0664 protein, His-tagged | +Inquiry |
Mki67-1781R | Recombinant Rat Mki67 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgE-507H | Native Human IgE protein | +Inquiry |
SOD1-101B | Active Native Bovine SOD | +Inquiry |
C3-194H | Native Human Complement C3c | +Inquiry |
TSH-1312B | Active Native Bovine TSH Protein | +Inquiry |
C-type lectin like protein-042H | Native Hen C-type lectin like protein Protein, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB1-578HCL | Recombinant Human SERPINB1 cell lysate | +Inquiry |
CSH2-7246HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
CPBTT30932GH | Goat Anti-Human Hemoglobin PAb, HRP-Conjugation | +Inquiry |
GJC1-294HCL | Recombinant Human GJC1 lysate | +Inquiry |
VTCN1-1096HCL | Recombinant Human VTCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITN1 Products
Required fields are marked with *
My Review for All ITN1 Products
Required fields are marked with *
0
Inquiry Basket