Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 9(Abcg9) Protein, His-Tagged
Cat.No. : | RFL8269AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter G family member 9(ABCG9) Protein (Q9SZR9) (1-638aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-638) |
Form : | Lyophilized powder |
AA Sequence : | MDNQEVSMDVETPIAKTNDDRSLPFSIFKKANNPVTLKFENLVYTVKLKDSQGCFGKNDK TEERTILKGLTGIVKPGEILAMLGPSGSGKTSLLTALGGRVGEGKGKLTGNISYNNKPLS KAVKRTTGFVTQDDALYPNLTVTETLVFTALLRLPNSFKKQEKIKQAKAVMTELGLDRCK DTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSILWELARG GRTVVTTIHQPSSRLFYMFDKLLLLSEGNPVYFGLGSNAMDYFASVGYSPLVERINPSDF LLDIANGVGSDESQRPEAMKAALVAFYKTNLLDSVINEVKGQDDLCNKPRESSRVATNTY GDWPTTWWQQFCVLLKRGLKQRRHDSFSGMKVAQIFIVSFLCGLLWWQTKISRLQDQIGL LFFISSFWAFFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFLSRVVGDLPMELILPTCF LVITYWMAGLNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFL LAGGYYVQHVPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDNGKLRCHVGDFEGIK HIGFNSGLVSALALTAMLVVYRVIAYIALTRIGKTKSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG9 |
Synonyms | ABCG9; WBC9; At4g27420; F27G19.20; ABC transporter G family member 9; ABC transporter ABCG.9; AtABCG9; Probable white-brown complex homolog protein 9; AtWBC9 |
UniProt ID | Q9SZR9 |
◆ Recombinant Proteins | ||
IGFL1-8753H | Recombinant Human IGFL1 protein, mFc-tagged | +Inquiry |
LY9-6231HF | Recombinant Full Length Human LY9 Protein, GST-tagged | +Inquiry |
SSBP1-2539Z | Recombinant Zebrafish SSBP1 | +Inquiry |
GM711-6927M | Recombinant Mouse GM711 Protein | +Inquiry |
PPP1R2P9-549C | Recombinant Cynomolgus Monkey PPP1R2P9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin A2-78H | Native Human Immunoglobulin A2 | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
Neuraminidase-008C | Active Native Clostridium perfringens Neuraminidase, Type V | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR37-350HCL | Recombinant Human WDR37 293 Cell Lysate | +Inquiry |
Fetal Skeletal Muscle -160H | Human Fetal Skeletal Muscle Lysate | +Inquiry |
CAMTA2-7870HCL | Recombinant Human CAMTA2 293 Cell Lysate | +Inquiry |
PGK2-3256HCL | Recombinant Human PGK2 293 Cell Lysate | +Inquiry |
WBP5-364HCL | Recombinant Human WBP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ABCG9 Products
Required fields are marked with *
My Review for All ABCG9 Products
Required fields are marked with *
0
Inquiry Basket