Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 25(Abcg25) Protein, His-Tagged
Cat.No. : | RFL25830AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter G family member 25(ABCG25) Protein (Q84TH5) (1-662aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-662) |
Form : | Lyophilized powder |
AA Sequence : | MSAFDGVENQMNGPDSSPRLSQDPREPRSLLSSSCFPITLKFVDVCYRVKIHGMSNDSCN IKKLLGLKQKPSDETRSTEERTILSGVTGMISPGEFMAVLGPSGSGKSTLLNAVAGRLHG SNLTGKILINDGKITKQTLKRTGFVAQDDLLYPHLTVRETLVFVALLRLPRSLTRDVKLR AAESVISELGLTKCENTVVGNTFIRGISGGERKRVSIAHELLINPSLLVLDEPTSGLDAT AALRLVQTLAGLAHGKGKTVVTSIHQPSSRVFQMFDTVLLLSEGKCLFVGKGRDAMAYFE SVGFSPAFPMNPADFLLDLANGVCQTDGVTEREKPNVRQTLVTAYDTLLAPQVKTCIEVS HFPQDNARFVKTRVNGGGITTCIATWFSQLCILLHRLLKERRHESFDLLRIFQVVAASIL CGLMWWHSDYRDVHDRLGLLFFISIFWGVLPSFNAVFTFPQERAIFTRERASGMYTLSSY FMAHVLGSLSMELVLPASFLTFTYWMVYLRPGIVPFLLTLSVLLLYVLASQGLGLALGAA IMDAKKASTIVTVTMLAFVLTGGYYVNKVPSGMVWMKYVSTTFYCYRLLVAIQYGSGEEI LRMLGCDSKGKQGASAATSAGCRFVEEEVIGDVGMWTSVGVLFLMFFGYRVLAYLALRRI KH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG25 |
Synonyms | ABCG25; WBC26; At1g71960; F17M19.11; ABC transporter G family member 25; ABC transporter ABCG.25; AtABCG25; White-brown complex homolog protein 26; AtWBC26 |
UniProt ID | Q84TH5 |
◆ Recombinant Proteins | ||
B5R-221M | Recombinant Monkeypox virus B5R Protein, His and Sumo-tagged | +Inquiry |
KCNC1A-7001Z | Recombinant Zebrafish KCNC1A | +Inquiry |
GTPBP6-3336HF | Recombinant Full Length Human GTPBP6 Protein, GST-tagged | +Inquiry |
IL1RL1-25C | Recombinant Cynomolgus IL1RL1 protein (Met1-Cys331), His-tagged | +Inquiry |
GTPBP4-4002M | Recombinant Mouse GTPBP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FG-163B | Native Bovine fibrinogen | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
Casein-01B | Active Native Bovine Casein Protein | +Inquiry |
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERP2-1941HCL | Recombinant Human SERP2 293 Cell Lysate | +Inquiry |
EFCAB6-640HCL | Recombinant Human EFCAB6 cell lysate | +Inquiry |
TUBB2A-651HCL | Recombinant Human TUBB2A 293 Cell Lysate | +Inquiry |
TPO-442HCL | Recombinant Human TPO cell lysate | +Inquiry |
ID1-5312HCL | Recombinant Human ID1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG25 Products
Required fields are marked with *
My Review for All ABCG25 Products
Required fields are marked with *
0
Inquiry Basket