Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 15(Abcg15) Protein, His-Tagged
Cat.No. : | RFL35574AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter G family member 15(ABCG15) Protein (Q8RWI9) (1-691aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-691) |
Form : | Lyophilized powder |
AA Sequence : | MELEGSSSGRRQLPSKLEMSRGAYLAWEDLTVVIPNFSDGPTRRLLQRLNGYAEPGRIMA IMGPSGSGKSTLLDSLAGRLARNVVMTGNLLLNGKKARLDYGLVAYVTQEDVLLGTLTVR ETITYSAHLRLPSDMSKEEVSDIVEGTIMELGLQDCSDRVIGNWHARGVSGGERKRVSIA LEILTRPQILFLDEPTSGLDSASAFFVIQALRNIARDGRTVISSVHQPSSEVFALFDDLF LLSSGESVYFGEAKSAVEFFAESGFPCPKKRNPSDHFLRCINSDFDTVTATLKGSQRIQE TPATSDPLMNLATSVIKARLVENYKRSKYAKSAKSRIRELSNIEGLEMEIRKGSEATWWK QLRTLTARSFINMCRDVGYYWTRIISYIVVSISVGTIFYDVGYSYTSILARVSCGGFITG FMTFMSIGGFPSFLEEMKVFYKERLSGYYGVSVYILSNYISSFPFLVAISVITGTITYNL VKFRPGFSHYAFFCLNIFFSVSVIESLMMVVASVVPNFLMGLITGAGLIGIIMMTSGFFR LLPDLPKIFWRYPVSYISYGSWAIQGGYKNDFLGLEFEPLFPGEPKMTGEEVIEKVFGVK VTYSKWWDLAAVVAILVCYRLLFFVVLKLRERAGPALKAIQAKRTMRNLDRRPSFKRMPS LSLSLSSMSSRRHQPLRSLSSQEGLNSPIHY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG15 |
Synonyms | ABCG15; WBC15; WBC22; At3g21090; MSA6.13; ABC transporter G family member 15; ABC transporter ABCG.15; AtABCG15; White-brown complex homolog protein 15; AtWBC15; White-brown complex homolog protein 22; AtWBC22 |
UniProt ID | Q8RWI9 |
◆ Native Proteins | ||
Lectin-1845S | Active Native Soybean Agglutinin Protein, Agarose bound | +Inquiry |
Lectin-1768D | Active Native Datura Stramonium Lectin Protein | +Inquiry |
Lectin-1732D | Active Native Dolichos Biflorus Agglutinin Protein, Rhodamine labeled | +Inquiry |
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
HbA1c-20R | Native Rat Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTC30A-681HCL | Recombinant Human TTC30A 293 Cell Lysate | +Inquiry |
CD48-2468MCL | Recombinant Mouse CD48 cell lysate | +Inquiry |
Testis-510C | Cynomolgus monkey Testis Lysate | +Inquiry |
RSL1D1-2133HCL | Recombinant Human RSL1D1 293 Cell Lysate | +Inquiry |
FAM19A1-6389HCL | Recombinant Human FAM19A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG15 Products
Required fields are marked with *
My Review for All ABCG15 Products
Required fields are marked with *
0
Inquiry Basket