Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 13(Abcg13) Protein, His-Tagged
Cat.No. : | RFL33290AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter G family member 13(ABCG13) Protein (Q9C8J8) (1-678aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-678) |
Form : | Lyophilized powder |
AA Sequence : | MTTPEGAMYVAWEDLTVVIPNFGEGATKRLLNGVNGCGEPNRILAIMGPSGSGKSTLLDA LAGRLAGNVVMSGKVLVNGKKRRLDFGAAAYVTQEDVLLGTLTVRESISYSAHLRLPSKL TREEISDIVEATITDMGLEECSDRTIGNWHLRGISGGEKKRLSIALEVLTKPSLLFLDEP TSGLDSASAFFVVQILRNIASSGKTVVSSIHQPSGEVFALFDDLLLLSGGETVYFGEAES ATKFFGEAGFPCPSRRNPSDHFLRCVNSDFDNVTAALVESRRINDSSFSLHQLHETTNTL DPLDDIPTAEIRTTLVRKFKCSLYAAASRARIQEIASIVGIVTERKKGSQTNWWKQLRIL TQRSFINMSRDLGYYWMRIAVYIVLSICVGSIFFNVGRNHTNVMSTAACGGFMAGFMTFM SIGGFQSFIEEMKVFSRERLNGHYGVAVYTVSNLLSSLPFIILMCLSTSSITIYMVRFQS GGSHFFYNCLDLICAITTVESCMMMIASVVPNFLMGVMLGAGYIGIMVLSAGFFRFFPDL PMVFWRYPVSYINYGAWALQGAYKNEMIGVEYDSPLPLVPKMKGELILQTVLGINPESSK WLDLAVVMMILIGYRIAFFAILKFREKVFPVIHMLYTKRTLSHIQKRPSFRRMTPFPSRR YPVHHALSSQEGLNSPLH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG13 |
Synonyms | ABCG13; WBC13; At1g51460; F5D21.8; ABC transporter G family member 13; ABC transporter ABCG.13; AtABCG13; White-brown complex homolog protein 13; AtWBC13 |
UniProt ID | Q9C8J8 |
◆ Recombinant Proteins | ||
DERL2-3002Z | Recombinant Zebrafish DERL2 | +Inquiry |
SCOT-2541H | Recombinant Human SCOT, GST-tagged | +Inquiry |
KRT35-6023HF | Recombinant Full Length Human KRT35 Protein, GST-tagged | +Inquiry |
PINK1-16P | Active Recombinant P. humanus PINK1 Protein, N-GST-tagged | +Inquiry |
Fas-4096R | Active Recombinant Rat Fas protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
CAPN2-350B | Native Bovine CAPN2 | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
FGG-53S | Native Sheep Fibrinogen | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ORAI3-459HCL | Recombinant Human ORAI3 lysate | +Inquiry |
TAF1A-1273HCL | Recombinant Human TAF1A 293 Cell Lysate | +Inquiry |
NF2-3862HCL | Recombinant Human NF2 293 Cell Lysate | +Inquiry |
CD300A-1809MCL | Recombinant Mouse CD300A cell lysate | +Inquiry |
ECHDC1-526HCL | Recombinant Human ECHDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG13 Products
Required fields are marked with *
My Review for All ABCG13 Products
Required fields are marked with *
0
Inquiry Basket