Recombinant Full Length Arabidopsis Thaliana Abc Transporter B Family Member 29, Chloroplastic(Abcb29) Protein, His-Tagged
Cat.No. : | RFL22743AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter B family member 29, chloroplastic(ABCB29) Protein (Q9LZB8) (52-634aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (52-634) |
Form : | Lyophilized powder |
AA Sequence : | ANTTVNSLKALETIKPYLQSESKTVLLGWLCSCVSVVSLSQIVPRLGSFTSNLNANAASL TKLKGECLVLAGLVLAKVVAYYLQQAFLWEAALNTVYKIRVFAYRRVLERELEFFEGGNG ISSGDIAYRITAEASEVADTIYALLNTVVPSAIQISVMTAHMIVASPALTLVSAMVIPSV ALLIAYLGDRLRKISRKAQIASAQLSTYLNEVLPAILFVKANNAEISESVRFQRFARADL DERFKKKKMKSLIPQIVQVMYLGSLSIFCVGAVILAGSSLSSSAIVSFVASLAFLIDPVQ DLGKAYNELKQGEPAIERLFDLTSLESKVIERPEAIQLEKVAGEVELCDISFKYDENMLP VLDGLNLHIKAGETVALVGPSGGGKTTLIKLLLRLYEPSSGSIIIDKIDIKDIKLESLRK HVGLVSQDTTLFSGTIADNIGYRDLTTGIDMKRVELAAKTANADEFIRNLPEGYNTGVGP RGSSLSGGQKQRLAIARALYQKSSILILDEATSALDSLSELLVREALERVMQDHTVIVIA HRLETVMMAQRVFLVERGKLKELNRSSLLSTHKDSLTSAGLVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCB29 |
Synonyms | ABCB29; ATH12; At5g03910; F8F6.120; ABC transporter B family member 29, chloroplastic; ABC transporter ABCB.29; AtABCB29; ABC2 homolog 12 |
UniProt ID | Q9LZB8 |
◆ Recombinant Proteins | ||
CCL2-120C | Recombinant Cynomolgus Monkey CCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fasl-625M | Recombinant Mouse Fasl protein, His & T7-tagged | +Inquiry |
Ppa1-5027M | Recombinant Mouse Ppa1 Protein, Myc/DDK-tagged | +Inquiry |
VASH1-9996M | Recombinant Mouse VASH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL16819HF | Recombinant Full Length Human Vesicle-Associated Membrane Protein 2(Vamp2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
LYZ-27700TH | Native Human LYZ | +Inquiry |
A35R-01M | Native Monkeypox virus A35R protein | +Inquiry |
IgG-170G | Native Goat IgG Fc fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF8-1746HCL | Recombinant Human TAF8 cell lysate | +Inquiry |
MEX3C-1513HCL | Recombinant Human MEX3C cell lysate | +Inquiry |
LCAT-4809HCL | Recombinant Human LCAT 293 Cell Lysate | +Inquiry |
MRPS5-4133HCL | Recombinant Human MRPS5 293 Cell Lysate | +Inquiry |
ARL14-8719HCL | Recombinant Human ARL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ABCB29 Products
Required fields are marked with *
My Review for All ABCB29 Products
Required fields are marked with *
0
Inquiry Basket