Recombinant Full Length Arabidopsis Thaliana 3-Ketoacyl-Coa Synthase 4(Kcs4) Protein, His-Tagged
Cat.No. : | RFL35549AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 3-ketoacyl-CoA synthase 4(KCS4) Protein (Q9LN49) (1-516aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-516) |
Form : | Lyophilized powder |
AA Sequence : | MDGAGESRLGGDGGGDGSVGVQIRQTRMLPDFLQSVNLKYVKLGYHYLISNLLTLCLFPL AVVISVEASQMNPDDLKQLWIHLQYNLVSIIICSAILVFGLTVYVMTRPRPVYLVDFSCY LPPDHLKAPYARFMEHSRLTGDFDDSALEFQRKILERSGLGEDTYVPEAMHYVPPRISMA AAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRS YNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVG GSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIA GETLKTNITTLGPLVLPISEQILFFMTLVVKKLFNGKVKPYIPDFKLAFEHFCIHAGGRA VIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRRGNRVWQIAFGS GFKCNSAIWEALRHVKPSNNSPWEDCIDKYPVTLSY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCS4 |
Synonyms | KCS4; At1g19440; F18O14.21; 3-ketoacyl-CoA synthase 4; KCS-4; Very long-chain fatty acid condensing enzyme 4; VLCFA condensing enzyme 4 |
UniProt ID | Q9LN49 |
◆ Recombinant Proteins | ||
HIPK4-3535HF | Recombinant Full Length Human HIPK4 Protein, GST-tagged | +Inquiry |
CTSK-914R | Recombinant Rhesus Macaque CTSK Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R8-2580C | Recombinant Chicken PPP1R8 | +Inquiry |
GRPCA-2374R | Recombinant Rat GRPCA Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL8887HF | Recombinant Full Length Human Pq-Loop Repeat-Containing Protein 1(Pqlc1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
Brain-10H | Native Human Brain Tissue Protein/Lysate | +Inquiry |
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP6-7529HCL | Recombinant Human CHMP6 293 Cell Lysate | +Inquiry |
DUSP5-6772HCL | Recombinant Human DUSP5 293 Cell Lysate | +Inquiry |
KIF26A-929HCL | Recombinant Human KIF26A cell lysate | +Inquiry |
TMEM189-977HCL | Recombinant Human TMEM189 293 Cell Lysate | +Inquiry |
SPOCK1-001HCL | Recombinant Human SPOCK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCS4 Products
Required fields are marked with *
My Review for All KCS4 Products
Required fields are marked with *
0
Inquiry Basket